Close
0
Inquiry Basket
Hot Products

Recombinant SARS-CoV-2 Surface glycoprotein (S) (319-541 aa) (W436R) [His-Tag], Mammalian cell

CAT#: GP02-135J

Datasheet Request COA
Specifications
Product Overview
Recombinant Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) Surface glycoprotein [319-541 aa (W436R)] was expressed in Mammalian cell with a 10xHis-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD(W436R) at 3 μg/mL can bind human ACE2, the EC50 is 526.3 ng/mL. This product can be used in ELISA, WB, IP.
Biological Activity
Determined by its binding ability to human ACE2 in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD(W436R) at 3 μg/mL can bind human ACE2, the EC50 is 526.3 ng/mL.
Source
Mammalian cell
Species
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
Fragment
319-541 aa (W436R)
Sequence
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIARNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Tag
10xHis-tag at the C-terminus
Predicted MW
27.8 kDa
Purity
>90%, determined by SDS-PAGE.
Endotoxin Level
<1.0 EU/μg, determined by the LAL method.
Conjugation
Unconjugated
Target Information
Target
S
Full Name
Surface glycoprotein
Gene ID
Uniprot ID
Background
Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is an enveloped, positive-sense, single-stranded RNA virus that causes coronavirus disease 2019 (COVID-19). Virus particles include the RNA genetic material and structural proteins needed for invasion of host cells. Once inside the cell the infecting RNA is used to encode structural proteins that make up virus particles, nonstructural proteins that direct virus assembly, transcription, replication and host control and accessory proteins whose function has not been determined.~ The structural proteins of SARS-CoV-2 include the envelope protein (E), spike or surface glycoprotein (S), membrane protein (M) and the nucleocapsid protein (N). The spike glycoprotein is found on the outside of the virus particle and gives coronavirus viruses their crown-like appearance. This glycoprotein mediates attachment of the virus particle and entry into the host cell. S protein is an important target for vaccine development, antibody therapies and diagnostic antigen-based tests.
Alternate Names
Spike glycoprotein
For Research Use Only.
Online Inquiry
Copyright © Creative Biolabs. All Rights Reserved.