Recombinant Suid herpesvirus 1 (SuHV-1) Envelope glycoprotein E (gE) (21-428 aa), Mammalian cell (CAT#: GPX-077-M-J)

Datasheet

Product Overview	Recombinant Suid herpesvirus 1 (strain Rice) (SuHV-1) Envelope glycoprotein E (21-428 aa) was expressed in Mammalian cell with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	Mammalian cell
Species	Suid herpesvirus 1 (strain Rice) (SuHV-1)
Fragment	21-428 aa
Sequence	TEAPSLSAETTPGPVTEVPSPSAEVWDLSTEAGDDDLDGDLNGDDRRAGFGSALASLREA PPAHLVNVSEGANFTLDARGDGAVVAGIWTFLPVRGCDAVAVTMVCFETACHPDLVLGRA CVPEAPERGIGDYLPPEVPRLQREPPIVTPERWSPHLTVRRATPNDTGLYTLHDASGPRA VFFVAVGDRPPAPLAPVGPARHEPRFHALGFHSQLFSPGDTFDLMPRVVSDMGDSRENFT ATLDWYYARAPPRCLLYYVYEPCIYHPRAPECLRPVDPACSFTSPARAALVARRAYASCS PLLGDRWLTACPFDAFGEEVHTNATADESGLYVLVMTHNGHVATWDYTLVATAAEYVTVI KELTAPARAPGTPWGPGGGDDAIYVDGVTTPAPPARPWNPYGRTTPGR
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	gE
Full Name	Envelope glycoprotein E
Uniprot ID	P08354
Background	In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions.
Alternate Names	Envelope glycoprotein E; gE

Recombinant Equine herpesvirus 1 (EHV-1) (strain Kentucky D) Envelope glycoprotein E (gE) (24-552 aa), E. coli (CAT#: GPX04-097J)
Recombinant Suid herpesvirus 1 (SuHV-1) Envelope glycoprotein E (gE) (21-428 aa), Baculovirus (CAT#: GPX-077-B-J)
Recombinant Pseudorabies virus (strain Rice) Envelope glycoprotein E (21-577 aa), E. coli (CAT#: GP05-358J)
Recombinant Equine herpesvirus 1 (strain Ab4p) (EHV-1) Envelope glycoprotein E (24-550 aa), E. coli (CAT#: GP05-154J)
Recombinant Equine herpesvirus 1 (strain AB1) (EHV-1) Envelope glycoprotein E (24-550 aa), E. coli (CAT#: GP05-149J)
Recombinant Suid herpesvirus 1 (SuHV-1) Envelope glycoprotein E (gE) (21-428 aa), Yeast (CAT#: GPX-077-Y-J)
Recombinant Suid herpesvirus 1 (strain Rice) Envelope glycoprotein E (gE) (21-577 aa), E. coli (CAT#: GPX04-420J)
Recombinant Equine herpesvirus 4 (EHV-4) (strain 1942) Envelope glycoprotein E (gE) (1-255 aa), E. coli (CAT#: GPX04-102J)

For Research Use Only.

Online Inquiry

Follow us on

Specifications