0
Inquiry Basket

There is no product in the shopping cart, buy it!

Recombinant Sumatran orangutan (Pongo abelii) Lysosomal associated membrane protein family member 5 (LAMP5) (30-234 aa) [His/Myc-Tag], E. coli (CAT#: GP02-067J)

Datasheet
SizeQtyAdd To Basket
100 μg
1 mg

Product Overview Recombinant Sumatran orangutan (Pongo abelii) Lysosomal associated membrane protein family member 5 (NP_001126676.1) (30-234 aa) was expressed in E. coli with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP.
Source E. coli
Species Sumatran orangutan (Pongo abelii)
Fragment 30-234 aa
Sequence EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE
Tag 10xHis-tag at the N-terminus and Myc-tag at the C-terminus
Predicted MW 30.4 kDa
Purity >95%, determined by SDS-PAGE.
Conjugation Unconjugated
Target LAMP5
Full Name Lysosomal associated membrane protein family member 5
Gene ID 100173676
Uniprot ID Q5R5V2
Accession Number NP_001126676.1
Background This protein plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain.
Alternate Names LAMP-5; BAD-LAMP; C20orf103
For Research Use Only.
Online Inquiry
Creative Biolabs-Glycoprotein Follow us on