There is no product in the shopping cart, buy it!
| Size | Qty | Add To Basket |
|---|---|---|
| 100 μg | ||
| 1 mg |
| Product Overview | Recombinant Sumatran orangutan (Pongo abelii) Lysosomal associated membrane protein family member 5 (NP_001126676.1) (30-234 aa) was expressed in Mammalian cell with a 10xHis-tag at the N-terminus and a Myc-tag at the C-terminus. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, IP. |
| Source | Mammalian cell |
| Species | Sumatran orangutan (Pongo abelii) |
| Fragment | 30-234 aa |
| Sequence | EQEVENLSGLSTNPEKDIFVVRENGTTCLMAEFAAKFIVPYDVWASNYVDLITEQADIALTRGAEVGRCGHSESELQVFWVDRAYALKMLFVKESHNMSKGPEETWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLASSDPQKTVTMILSAVHIQPFDIISDFVFSEEHKCAVDEREQLEE |
| Tag | 10xHis-tag at the N-terminus and Myc-tag at the C-terminus |
| Predicted MW | 28 kDa |
| Purity | >95%, determined by SDS-PAGE. |
| Conjugation | Unconjugated |
| Target | LAMP5 |
| Full Name | Lysosomal associated membrane protein family member 5 |
| Gene ID | 100173676 |
| Uniprot ID | Q5R5V2 |
| Accession Number | NP_001126676.1 |
| Background | This protein plays a role in short-term synaptic plasticity in a subset of GABAergic neurons in the brain. |
| Alternate Names | LAMP-5; BAD-LAMP; C20orf103 |