Recombinant Turkey rhinotracheitis virus (TRTV) Major surface glycoprotein G (G) (1-391 aa), E. coli (CAT#: GPX04-436J)

Product Overview	Recombinant Turkey rhinotracheitis virus (TRTV) Major surface glycoprotein G (NP_065402.1) (1-391 aa) was expressed in E. coli with a His-tag or Tag free. The biological activity was determined by its binding ability in a functional ELISA. This product can be used in ELISA, WB, and IP.
Biological Activity	Determined by its binding ability in a functional ELISA.
Source	E. coli
Species	Turkey rhinotracheitis virus (TRTV)
Fragment	1-391 aa
Sequence	MGSKLYMVQGTSAYQTAVGFWLDIGRRYILAIVLSAFGLTCTVTIALTVSVIVEQSVLEE CRNYNGGDRDWWSTTQEQPTTAPSATPAGNYGGLQTARTRKSESCLHVQISYGDMYSRSD TVLGGFDCMGLLVLCKSGPICQRDNQVDPTALCHCRVDLSSVDCCKVNKISTNSSTTSEP QKTNPAWPSQDNTDSDPNPQGITTSTATLLSTSLGLMLTSKTGTHKSGPPQALPGSNTNG KTTTDREPGPTNQPNSTTNGQHNKHTQRMTPPPSHDNTRTILQHTTPWEKTFSTYKPTHS PTNESDQSLPTTQNSINCEHFDPQGKEKICYRVGSYNSNITKQCRIDVPLCSTYSTVCMK TYYTEPFNCWRRIWRCLCDDGVGLVEWCCTS
Tag	His-tag or Tag free
Purity	>90%, determined by SDS-PAGE.
Conjugation	Unconjugated

Target	G
Full Name	Major surface glycoprotein G
Gene ID	911729
Uniprot ID	P33495
Accession Number	NP_065402.1
Background	Isoform Membrane-bound glycoprotein G attaches the virion to the host cell membrane by interacting with heparan sulfate, initiating the infection. Isoform Secreted glycoprotein G helps the virus escape antibody-dependent restriction of replication by acting as an antigen decoy and by modulating the activity of leukocytes bearing Fc-gamma receptors.
Alternate Names	Major surface glycoprotein G