Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GNRHR
The gonadotropin-releasing hormone receptor (GNRHR) is a receptor protein encoded by gene GNRHR. This receptor is a member of the G-protein coupled receptor (GPCR) family and expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary and prostate. It can promote the release of a gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH) by binding with GNRHR.
| Basic Information of GNRHR | |
| Protein Name | Gonadotropin-releasing hormone receptor |
| Gene Name | GNRHR |
| Aliases | GnRH-R, GRHR, LHRHR, LRHR |
| Organism | Homo sapiens (Human) |
| UniProt ID | P30968 |
| Transmembrane Times | 7 |
| Length (aa) | 328 |
| Sequence |
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL SDPVNHFFFLFAFLNPCFDPLIYGYFSL |
Function of GNRHR Membrane Protein
GNRHR is a receptor for the gonadotropin-releasing hormone. It is the central point of the hypothalamus secretion produced and secreted by the combination of hypothalamic GnRH and pituitary gonadotropin in mammals. The combination of GNRHR and GnRH results in the dissociation of receptor-related heterogeneous dimer G protein and the initiation of several intracellular signaling cascades and causes extracellular and intracellular calcium fluxes, several MAPK pathways of activation, including those that lead to ERK1 activation and C-jun N-terminal kinase (JNK) pathways.
Application of GNRHR Membrane Protein in Literature
This article reports that endogenous GnRH acts on GnRHR neurons and triggers burst to fire in these cells during late proestrus and estrus.
The article demonstrates that the GnRH-GnRHR system is not required for growth or exercise/sensory/directional behavior for the first month prior to the onset of puberty. However, the lack of the GnRH-GnRHR axis results in a decrease in the weight of the female subcutaneous inguinal fat pad and an increase in glucose and may result in insulin resistance.
The article demonstrates that the first direct interaction partner of GnRHR is SET, which is helpful for the conversion of GnRHR signaling to the cAMP pathway.
This article shows that the GnRHR expression is very low in gastric cancer, and the loss of GnRHR expression could be a poor prognostic factor, which implied that GnRHR could play an important role in the development of gastric cancer.
This article assesses the aberrant expression of the gonadotropin-releasing hormone receptor (GnRHR) in human adrenal tissue, including aldosterone-producing adenomas (APA). And the ectopic expression of GnRH through its receptor may be a potential regulator of CYP11B2 expression levels in certain APA cases.
GNRHR Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GNRHR antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
