Introduction of GPER1
GPER1 is a kind of G protein-coupled receptor analog GPCR-Br cDNA obtained from human breast cancer cells by subtractive hybridization in the late 1990s. It was confirmed by comparing its cDNA and gene library to a new G protein. The full-length gene is 2 604 bp and is located on chromosome 7p22, including a non-coding region of 504 bp on the 5' end, a non-coding region of 972 bp on the 3' terminus, and an 1128 bp long encoding region. It has 375 amino acids, an open reading frame of a protein with a molecular mass of approximately 4227 u.
| Basic Information of GPER1 | |
| Protein Name | G-protein coupled estrogen receptor 1 |
| Gene Name | GPER1 |
| Aliases | FEG-1, GPCR-Br, LYGPR, mER, CEPR, CMKRL2, DRY12, GPER |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q99527 |
| Transmembrane Times | 7 |
| Length (aa) | 375 |
| Sequence |
MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCL YTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAV LCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVP FTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQK ALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLN PLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV |
Function of GPER1 Membrane Protein
GPER1 is widely distributed in many tissues, such as the female reproductive system, central hippocampal tissue, cardiovascular system, and various cancer tissues including breast cancer, prostate cancer, endometrial cancer, and ovarian cancer. Moreover, a number of studies have shown that the expression level is related to the tissue type, development level, and pathological state. GPER1 also plays a role in the slow gene effect, which is mainly manifested by the rapid non-gene effect mediating a series of other protein changes and regulating the expression of genes in the nucleus. However, the GPER1 response element has not yet been found, and GPER1 has not been found as classic.
Fig.1 The signaling pathway initiated by estrogen in MCF-7 cells. (Ji, 2016)
Application of GPER1 Membrane Protein in Literature
This article reports that interaction with synaptic scaffold proteins (such as SAP97) is a prerequisite for the action of GPER1 in synapses, and estrogen may accumulate on the same synaptic element due to the action of GPER1.
This article investigates that GPER1 is involved in the control of anxiety and stress, and its effect is more effective in male mice.
The article reveals that age and menopausal-related damage in working memory in humans and non-human primates is mediated by the dorsolateral prefrontal cortex (diPFC), and the key to synaptic plasticity in monkey diPFC multifunction is GPER1.
This article shows that GPER1 is becoming a candidate therapeutic target for cardiovascular and metabolic diseases due to its beneficial effects in the cardiovascular system.
This article evaluates that E2 action was mediated by GPER1 signaling pathway by using pharmacological and RNA silencing approaches and demonstrates that GPER1 can be a possible target in this disease.
GPER1 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPER1 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.