Close

GPR1 Membrane Protein Introduction

Introduction of GPR1

GPR1 is a protein that in humans is encoded by the GPR1 gene, also called G-protein coupled receptor 1. It is a member of the G protein-coupled receptor family of transmembrane receptors. GPR1 functions as a receptor for chemerin. Chemerin is an 18 KD non-biologically active complex protein called chemerin precursor (prochemerin) whose cleavage of the C-terminal part by an extracellular serine protease and can be converted to a chemerin protein with a high bioactivity of 16 KD.

Basic Information of GPR1
Protein Name G-protein coupled receptor 1
Gene Name GPR1
Aliases GPCR6, PAGH2, PITA2
Organism Homo sapiens (Human)
UniProt ID P46091
Transmembrane Times 7
Length (aa) 355
Sequence MEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARFRSSVAEILKYTLWEVSCSGTVSEQLRNSETKNLCLLETAQ

Function of GPR1 Membrane Protein

GPR1 was associated with adipose differentiation. Silencing GPR1 gene significantly reduced lipid accumulation and inhibited C/EBPα and PPARγ mRNA expression as well as FABP4 and inflammatory cytokines TNF-α and IL-6 mRNA expression. It was suggested that in the process of 3T3-L1 preadipocyte differentiation, on the one hand, GPR1 may interfere with the expression of C/EBPα, thereby affecting the activation of downstream PPARγ and FABP4, resulting in inhibition of adipocyte differentiation. On the other hand, GPR1 may inhibit inflammatory cytokines. In addition, the expression of TNF-α and IL-6 mRNA enhances the sensitivity of TNF-α and insulin, thereby improving the metabolic disturbance caused by TNF-α and insulin resistance, reducing the accumulation of lipids in adipocytes, and inhibiting the differentiation of adipocytes.

GPR1 Membrane Protein Introduction

Application of GPR1 in Literature

  1. Zheng C., et al. FAM19A1 is a new ligand for GPR1 that modulates neural stem-cell proliferation and differentiation. FASEB J. 2018. PubMed ID: 29799787

    This article reports that FAM19A is a novel regulator of neural stem cell proliferation and differentiation, and the effect of FAM19A on NSC function is mediated by GPCR, which is likely to play an important role in brain development and neurogenesis through a mechanism.

  2. Yang Y.L., et al. Deficiency of Gpr1 improves steroid hormone abnormality in hyperandrogenized mice. Reprod Biol Endocrinol. 2018, 16(1): 50. PubMed ID: 29793502

    This article reveals that the improvement in steroid synthesis in mice are highly harmonized with DHEA which is due to GPR1 deficiency, so a therapeutic target for GHEA-induced androgen excess may be GPR1.

  3. Kennedy A.J., et al. International Union of Basic and Clinical Pharmacology CIII: Chemerin Receptors CMKLR1 (Chemerin1) and GPR1 (Chemerin2) Nomenclature, Pharmacology, and Function. Pharmacol Rev. 2018, 70(1): 174-196. PubMed ID: 29279348

    This paper shows that the mice show glucose intolerance after knocking out the GPR1 gene and chemerin receptors are related to cardiovascular disease, cancer, steroidogenesis, human immunodeficiency virus replication, and neurogenesis.

  4. Kennedy A.J., et al. Chemerin Elicits Potent Constrictor Actions via Chemokine-Like Receptor 1 (CMKLR1), not G-Protein-Coupled Receptor 1 (GPR1), in Human and Rat Vasculature. J Am Heart Assoc. 2016, 5(10). PubMed ID: 27742615

    The article shows that chemerin can increase blood pressure and cause high blood pressure and it acts on CMKLR1 but does not work with GPR1.

  5. De Henau O., et al. Signaling Properties of Chemerin Receptors CMKLR1, GPR1 and CCRL2. PLoS One. 2016. PubMed ID: 27716822

    This article shows that phosphorylation of ERK1/2 MAP kinase and internalization of two receptors is due to the combination of chemerin and CMKLR1 and GPR1.

GPR1 Preparation Options

To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR1 antibody development services.


As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.


All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us