Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GPR157
GPR157 belongs to the G-protein-coupled receptor (GPCR) family which constitutes the largest family of membrane receptors that transduce environmental signals into the cell by activating the cognate heterotrimeric G-proteins. GPR157 is encoded by the GPR157 gene which is located at 1p36.22, and the mass of which is 36,623 Da. GPR157 is expressed in the primary cilia of radial glial progenitors (RGPs) exposed to the cerebrospinal fluid.
| Basic Information of GPR157 | |
| Protein Name | G-protein coupled receptor 157 |
| Gene Name | GPR157 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q5UAW9 |
| Transmembrane Times | 7 |
| Length (aa) | 335 |
| Sequence | MQPSPPPTELVPSERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQNFAGPSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRAARGPRTDRLLWAFHVVSWGVPLVITVAAVALKKIGYDASDVSVGWCWIDLEAKDHVLWMLLTGKLWEMLAYVLLPLLYLLVRKHINRAHTALSEYRPILSQEHRLLRHSSMADKKLVLIPLIFIGLRVWSTVRFVLTLCGSPAVQTPVLVVLHGIGNTFQGGANCIMFVLCTRAVRTRLFSLCCCCCSSQPPTKSPAGTPKAPAPSKPGESQESQGTPGELPST |
Function of GPR157 Membrane Protein
The activity of GPR157 receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger. GPR157 also plays important roles in many biological processes, such as circadian behavior, positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway and cell surface receptor signaling pathway. Generally, Gα proteins can be divided into four subfamilies(Gα s, Gα i, Gα q, Gα 12/13), and it has been found that GPR157 couples with Gαq-class of the heterotrimeric G-proteins. What’ s more, in the developing neocortex, GPR157 is located in the primary cilia of radial glial progenitors (RGPs), and knockdown of GPR157 will inhibit neuronal differentiation of RGPs. Noticeably, GPR157 couples with Gαq and activates PLC-IP3 pathway. At the same time, GPR157-Gq-IP3 signaling contributes to neuronal differentiation of RGPs, it is supported by finding of decreased neuronal differentiation of RGPs in vivo upon depletion of GPR157, inactivation of Gαq and overexpression of IP3 sponge that sequesters IP3 and suppress IP3-dependent Ca2+ release from Ca2+ stores.
Fig.1 Model of GPR157 signaling in radial glial progenitors (Takeo, 2016).
Application of GPR157 Membrane Protein in Literature
This article suggests that GPR157 couples with Gq-class of the heterotrimeric G-proteins and signals through IP3-mediated Ca2+ cascade, and GPR157 regulates neuronal differentiation of radial glial progenitors through the Gq-IP3 pathway.
Authors in this passage identify the genetic basis of Schnyder crystalline corneal dystrophy (SCCD) through screening of positional candidate genes in affected patients, and they find some novel SNPs in both affected and unaffected individuals in GPR157, MGC4399, and H6PD.
Authors in this group focus on deciphering evolutionarily conserved orphan G-protein-coupled receptors from homolog cluster, and then four O-GPCRs (GPR139, GPR142, GPR148, and GPR157) which were topologically close to each other with minimum evolutionary distances are identified.
This review summarizes and analyzed by 2006 the literature data on signaling systems coupled to G-proteins the ameba Dictyostelium discoideum, in mammalian genome, GPR133 and GPR157 orphan receptors have a relatively high homology with CAR, which is the most pronounced in the region of cAMP-binding domain.
GPR157 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR157 antibody development services.
As a forward-looking research institute as well as a leading customer service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
