Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GPR20
GPR20 is encoded by the GPR20 gene. It belongs to the G-protein-coupled receptor (GPCR) family which has been greatly studied during the past few years. GPCRs are potential drug targets of about 34% of all modern clinical drugs because they are involved in many different diseases. GPR20 is one of a class A orphan GPCRs which has a similar structure to other identified GPCRs, whose endogenous ligand has not yet been identified.
| Basic Information of GPR20 | |
| Protein Name | G-protein coupled receptor 20 |
| Gene Name | GPR20 |
| Aliases | NA |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q99678 |
| Transmembrane Times | 7 |
| Length (aa) | 358 |
| Sequence | MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSPCCRVFALTVLEFRLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA |
Function of GPR20 Membrane Protein
The activity of GPR20 is regulated by G proteins, leading in the constitutive activation of its coupled G proteins in the absence of ligand. The basal level and the prostaglandin E2-induced production of cAMP were significantly decreased in HEK293 cell expressed GPR20 exogenously. A few studies also reported that the expression of GPR20 evaluates in the gastrointestinal tract such as the small intestine and the large intestine. The high expression of GPR20 can activate Gi proteins constitutively even through the absence of its ligand stimulation. Although the biological role of GPR20, as well as its endogenous ligand remain unclear, GPR20 is reported to be involved in many different cellular signaling processes, including control of intracellular cAMP levels and mitogenic signaling. Besides, a few studies reveal that GRP20 is closely related to nucleotide or lipid receptors and may have an important role in regulating the intestinal lipid transport.
Fig.1 Functional diagram of GPR20. (Hase, 2008)
Application of GPR20 Membrane Protein in Literature
This article reports that GPR20 is involved in activation of Gi proteins and inhibition of the prostaglandin E(2)-induced cAMP production without its ligand stimulation.
This article reveals that the gene of GPR20 was isolated by screening of a genomic library. The expression of GPR20 is detected in several human brain regions and also in liver by northern blot analysis.
This article focuses on evaluating the biological function of orphan class-A G-protein coupled receptors in the cAMP signaling pathway. It shows that GPR20 can inhibit the expression of CRE-mediated gene in GPR20 transiently expressed CHO-K1 cells.
Authors in this group analyzed about 50,000 genomic variants of 71 people from 'Paisa' pedigree and some GPR20 functional variants are involved in the Alzheimer's disease (AD). These variants of GPR20 are useful for finding the potential treatments for Alzheimer's disease.
GPR20 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR20 antibody development services.
As a forward-looking research organization as well as a leading customer service provider with an excellent reputation in the field of membrane protein, Creative Biolabs is famous for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information and services.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
