Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GPR84
Probable G-protein coupled receptor 84 (GPR84) is a protein that in humans is encoded by the GPR84 gene. The gene locates to chromosome 12q13.13, and its coding sequence is not interrupted by introns. It turned out that GPR84 belongs to the Th1 specific subset genes. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity. Among the related pathways of GPR84 are innate immune system and signaling by GPCR. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G (i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.
| Basic Information of GPR84 | |
| Protein Name | G-protein coupled receptor 84 |
| Gene Name | GPR84 |
| Aliases | Inflammation-related G-protein coupled receptor EX33, EX33 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9NQS5 |
| Transmembrane Times | 7 |
| Length (aa) | 396 |
| Sequence | MWNSSDANFSCYHESVLGYRYVAVSWGVVVAVTGTVGNVLTLLALAIQPKLRTRFNLLIANLTLADLLYCTLLQPFSVDTYLHLHWRTGATFCRVFGLLLFASNSVSILTLCLIALGRYLLIAHPKLFPQVFSAKGIVLALVSTWVVGVASFAPLWPIYILVPVVCTCSFDRIRGRPYTTILMGIYFVLGLSSVGIFYCLIHRQVKRAAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGKVTRMCFAVFLCFALSYIPFLLLNILDARVQAPRVVHMLAANLTWLNGCINPVLYAAMNRQFRQAYGSILKRGPRSFHRLH |
Function of GPR84 Membrane Protein
The importance of GPCRs in the regulation of β-catenin signaling and tumorigenesis has been increasingly recognized. A recent report has identified GPR84 as a leukemia stem cell-specific gene. GPR84 may also play a proinflammatory role and can be used as a novel target to treat chronic low-grade inflammation associated-disease. Microglia surrounds the amyloid plaques that form in the brains of patients with Alzheimer's disease (AD) and these cells can express GPR84 under inflammatory conditions. GPR84 acts as a sensor for a yet unknown ligand that promotes microglia recruitment, thus preventing further cognitive decline by playing a role in amyloid pathology.
Fig.1 The Gi protein-coupled receptor GPR84, which is activated by (hydroxy) fatty acids, is highly expressed on immune cells. (Pillaiyar, 2017)
Application of GPR84 Membrane Protein in Literature
The results reveal a previously unrecognized role of GPR84 in maintaining fully developed acute myeloid leukemia (AML) by sustaining aberrant β-catenin signaling in LSCs. It suggests that targeting the oncogenic GPR84/β-catenin signaling axis may represent a novel therapeutic strategy for AML.
The article reports that GPR84 acts as a sensor for a yet unknown ligand that promotes microglia recruitment, thus preventing further cognitive decline by playing a role in amyloid pathology.
The authors in this group found that GPR84 is a proinflammatory receptor and may be a novel target to treat chronic low-grade inflammation associated-disease.
This article focuses on the mutation analysis and molecular modeling for the investigation of ligand-binding modes of GPR84. The results suggest that diindolylmethane is a positive allosteric modulator for GPR84.
This article evaluates the roles of Gpr84 in immune regulation. It shows that Gpr84 may play a role in directly linking fatty acid metabolism to immunological regulation.
GPR84 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR84 antibody development services.
As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and help you with the research of membrane proteins. Please do not hesitate to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
