Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GPR88
Probable G-protein coupled receptor 88 (GPR88) is a protein that in humans is encoded by the GPR88 gene. Among its related pathways are GPCRs, Other. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity. A previous study found that GPR88 plays an important role in the physiology of dorsal striatal projection neurons and in behaviors involving this brain region.
| Basic Information of GPR88 | |
| Protein Name | Probable G-protein coupled receptor 88 |
| Gene Name | GPR88 |
| Aliases | Striatum-specific G-protein coupled receptor, STRG |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9GZN0 |
| Transmembrane Times | 7 |
| Length (aa) | 384 |
| Sequence | MTNSSSTSTSSTTGGSLLLLCEEEESWAGRRIPVSLLYSGLAIGGTLANGMVIYLVSSFRKLQTTSNAFIVNGCAADLSVCALWMPQEAVLGLLPTGSAEPPADWDGAGGSYRLLRGGLLGLGLTVSLLSHCLVALNRYLLITRAPATYQALYQRRHTAGMLALSWALALGLVLLLPPWAPRPGAAPPRVHYPALLAAAALLAQTALLLHCYLGIVRRVRVSVKRVSVLNFHLLHQLPGCAAAAAAFPGAQHAPGPGGAAHPAQAQPLPPALHPRRAQRRLSGLSVLLLCCVFLLATQPLVWVSLASGFSLPVPWGVQAASWLLCCALSALNPLLYTWRNEEFRRSVRSVLPGVGDAAAAAVAATAVPAVSQAQLGTRAAGQHW |
Function of GPR88 Membrane Protein
The GPR88 gene is a G protein-coupled receptor found almost exclusively in the striatum, a brain structure that controls motor function and cognition. Defects in this gene are related to learning difficulties, speech delay, some neuropsychiatric disorders, and chorea. Probable G-protein coupled receptor implicated in a large repertoire of behavioral responses that engage motor activities, spatial learning, and emotional processing and may play a role in the regulation of cognitive and motor function. Several diseases are associated with GPR88, such as chorea, Childhood-Onset, With Psychomotor Retardation.
Fig.1 Knockout of GPR88 leads to hyperexcitation and more regular firing patterns in striatal MSNs, as well as impairment in cued response learning. (Lovinger, 2012)
Application of GPR88 Membrane Protein in Literature
The article reports that GPR88 activity shapes the mouse brain functional and structural connectome. Connectivity alterations and behavior deficits were observed in Gpr88-deficient mice.
The article points out that the expression of GPR88 is crucial to efficiently integrate effort and energy density information guiding instrumental selection. Both humans and mice with nonfunctional GPR88 have been shown to present striatal dysfunctions and impaired learning.
Authors in this group found that Gpr88 expressed in A2AR neurons enhances ethological anxiety-like behaviors without affecting conflict anxiety and fear responses.
This article focuses on the developmental and adult expression patterns of the G-protein-coupled receptor GPR88 in the rat. The results suggest that nonclassical GPCR modes of action of GPR88 could be relevant for cortical development and psychiatric disorders.
This article reports that GPR88 is implicated in a large repertoire of behavioral responses that engage motor activity, spatial learning, and emotional processing, which indicates that the therapeutic potential of GPR88 may extend to cognitive and anxiety disorders.
GPR88 Preparation Options
To obtain the soluble and functional target protein, the versatile Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPR88 antibody development services.
As a leading service provider, Creative Biolabs is proud to present our professional service in membrane protein preparation and help you with the research of membrane proteins. Please do not hesitate to contact us for more details.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
