GPRC5B Membrane Protein Introduction

Introduction of GPRC5B

G-protein coupled receptor family C group 5 member B (GPRC5B) is a protein encoded by the GPRC5B gene. This protein is one of the defined CPRC5 receptors (the others are GPRC5A, GPRC5C, GPRC5D), which are classified as family C G protein-coupled receptors (GPCRs). GPRC5 receptors share approximately 30-40% sequence homology to each other and 25% homology to the other family C members. Members of this superfamily are characterized by a signature 7-transmembrane domain motif. Analysis of the protein sequence reveals that CPRC5B contains short extracellular amino-terminal domains (ATDs). Moreover, this receptor undergoes alternative splicing and produces multiple transcript variants.

Basic Information of GPRC5B
Protein Name	G-protein coupled family C group 5 member B
Gene Name	GPRC5B
Aliases	A-69G12.1, RAIG-2
Organism	Homo sapiens (Human)
UniProt ID	Q9NZH0
Transmembrane Times	7
Length (aa)	403
Sequence	MFVASERKMRAHQVLTFLLLFVITSVASENASTSRGCGLDLLPQYVSLCDLDAIWGIVVE AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLTFAFIIQEDET ICSVRRFLWGVLFALCFSCLLSQAWRVRRLVRHGTGPAGWQLVGLALCLMLVQVIIAVEW LVLTVLRDTRPACAYEPMDFVMALIYDMVLLVVTLGLALFTLCGKFKRWKLNGAFLLITA FLSVLIWVAWMTMYLFGNVKLQQGDAWNDPTLAITLAASGWVFVIFHAIPEIHCTLLPAL QENTPNYFDTSQPRMRETAFEEDVQLPRAYMENKAFSMDEHNAALRTAGFPNGSLGKRPS GSLGKRPSAPFRSNVYQPTEMAVVLNGGTIPTAPPSHTGRHLW

Functions of GPRC5B Membrane Protein

GPRC5B is broadly expressed in tissues of nematodes, flies, fish, birds, mice, and humans. Studies find that this protein potentially mediates the cellular effects of retinoic acid on G protein signaling. Moreover, it has been shown human GPRC5B mRNA is robustly expressed in the central nervous system (e.g., the cerebellum and other brain regions) and in the adipose tissues. Studies have suggested that this receptor is associated with several human diseases, such as obesity, attention-deficit/hyperactivity disorder, and major depression.

GPRC5B Membrane Protein Introduction

Application of GPRC5B Membrane Protein in Literature

Robbins M. J., et al. Localisation of the GPRC5B receptor in the rat brain and spinal cord. Brain Research Molecular Brain Research. 2002, 106(1-2): 136. PubMed ID: 12393273

This article investigated both the mRNA and protein expression profiles of GPRC5B in the rat brain and spinal cord.
Sano T., et al. Comparative characterization of GPRC5B and GPRC5CLacZ knockin mice; behavioral abnormalities in GPRC5B-deficient mice. Biochemical & Biophysical Research Communications. 2011, 412(3): 460-5. PubMed ID: 21840300

This article used GPRC5B-deficient mice to study the functions of this protein in the central nervous system and GPRC5B-deficient mice showed altered spontaneous activity pattern and decreased response to a new environment. Expression of this protein was regulated during the brain development.
Soni A., et al. GPRC5B a putative glutamate-receptor candidate is negative modulator of insulin secretion. Biochemical & Biophysical Research Communications. 2013, 441(3): 643-648. PubMed ID: 24404583

This article studied GPRC5B expression in mouse and human pancreatic islets and the results suggested that the pharmacological targeting of GPRC5B might provide a novel means therapy for the treatment and prevention of type-2 diabetes.
Kwon S. H., et al. Intercellular transfer of GPRC5B via exosomes drives HGF-mediated outward growth. Current Biology Cb. 2014, 24(2): 199. PubMed ID: 24412205

This article found that GPRC5B was elevated in urinary exosomes from patients with acute kidney injury. Exosomal transfer of GPRC5B stimulated tubule growth via ERK1/2 activation and blockade of the apical release of this receptor via exomes decreased tubule growth.
Sano T., et al. Loss of GPRC5B impairs synapse formation of Purkinje cells with cerebellar nuclear neurons and disrupts cerebellar synaptic plasticity and motor learning. Neuroscience Research. 2018. PubMed ID: 29481883

This article studied the function of GPRC5B in Gprc5b^-/- mice and the results suggested that GPRC5B played not only an important role in the development of distal axons of Purkinje cells and formation of synapses with deep cerebellar nuclei neurons but also in the synaptic plasticity that underlies long-term motor learning.

GPRC5B Preparation Options

Based on our Magic™ membrane protein production platform, Creative Biolabs is specialized in the preparation of the most challenging targets such as G-protein coupled membrane proteins, ion channels, and other membrane proteins using different reconstitution systems, such as the detergent micelles, liposomes, nanodiscs, amphipols, and SMALPs. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GPRC5B antibody development services.

We combine our advanced proteomic technologies and our long-term scientific expertise in the fields of membrane biochemistry to provide our clients with the best quality services at reasonable prices. Contact us for more details about our membrane protein preparation services.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: