Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of GRM8
GRM8 (mGluR8) is a group III metabotropic glutamate receptor (mGluR) and it is a member of family C G-protein coupled receptor. As with other mGluRs, this receptor has a large extracellular domain, termed the Venus Flytrap domain, which contains the glutamate-binding site. GRM8 is expressed at lower levels than the other group III mGluRs but is widely distributed in the brain. It is discovered to be localized mainly presynaptically where it regulates neurotransmitter release but is also identified in some postsynaptic locations and in the periphery. The gene coding GRM8 is exceptionally large, spanning about 1000 kb of genomic DNA.
| Basic Information of GRM8 | |
| Protein Name | Metabotropic glutamate receptor 8 |
| Gene Name | GRM8 |
| Organism | Homo sapiens (Human) |
| UniProt ID | O00222 |
| Transmembrane Times | 7 |
| Length (aa) | 908 |
| Sequence |
MVCEGKRSASCPCFFLLTAKFYWILTMMQRTHSQEYAHSIRVDGDIILGGLFPVHAKGER GVPCGELKKEKGIHRLEAMLYAIDQINKDPDLLSNITLGVRILDTCSRDTYALEQSLTFV QALIEKDASDVKCANGDPPIFTKPDKISGVIGAAASSVSIMVANILRLFKIPQISYASTA PELSDNTRYDFFSRVVPPDSYQAQAMVDIVTALGWNYVSTLASEGNYGESGVEAFTQISR EIGGVCIAQSQKIPREPRPGEFEKIIKRLLETPNARAVIMFANEDDIRRILEAAKKLNQS GHFLWIGSDSWGSKIAPVYQQEEIAEGAVTILPKRASIDGFDRYFRSRTLANNRRNVWFA EFWEENFGCKLGSHGKRNSHIKKCTGLERIARDSSYEQEGKVQFVIDAVYSMAYALHNMH KDLCPGYIGLCPRMSTIDGKELLGYIRAVNFNGSAGTPVTFNENGDAPGRYDIFQYQITN KSTEYKVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCER CEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPIIKLEWHSPWAVVPVFVAILGIIATTF VIVTFVRYNDTPIVRASGRELSYVLLTGIFLCYSITFLMIAAPDTIICSFRRVFLGLGMC FSYAALLTKTNRIHRIFEQGKKSVTAPKFISPASQLVITFSLISVQLLGVFVWFVVDPPH IIIDYGEQRTLDPEKARGVLKCDISDLSLICSLGYSILLMVTCTVYAIKTRGVPETFNEA KPIGFTMYTTCIIWLAFIPIFFGTAQSAEKMYIQTTTLTVSMSLSASVSLGMLYMPKVYI IIFHPEQNVQKRKRSFKAVVTAATMQSKLIQKGNDRPNGEVKSELCESLETNTSSTKTTY ISYSNHSI |
Functions of GRM8 Membrane Protein
GRM8 knockout mice are found to show enhanced anxiety and weight gain compared to normal animals. The severity degree of anxiety-behaviors is sex-dependent. Moreover, a null mutation in the GRM8 gene resulted in robust cognitive performance deficits and spatial learning. Because of the important roles in modulating neurotransmission, GRM8 has been regarded as attractive therapeutic target for anxiety disorders. Besides, the expression of this receptor in peripheral tissues, such as the gut and pancreas, may play a role in gastrointestinal motility and insulin secretion in vivo. More specific functions of mGluR8 remain to be established.
Applications of GRM8 Membrane Protein in Literature
This study investigated the effects of mGluR8 activation on anxiety-like behavior, voluntary ethanol intake, and ethanol-induced conditioned reward. The results showed that the activation of this receptor reduced voluntary ethanol intake and that the mGluR8 signaling might contribute to the rewarding properties of ethanol.
This study investigated the interaction between group III mGluRs (mGluR8) and transient receptor potential ankyrin 1 (TRPA1) on cutaneous nociceptors in rats. The results showed that the agonists of group III mGluRs might be effective in the treatment of mechanical hypersensitivity.
This study demonstrated the genetic association of GRM7 and GMR8 with schizophrenia and major depressive disorders in the Han Chinese population.
This article assessed the potential effects of acute pharmacological modulation of mGluR8 on anxiety. mGluR8 was stimulated with specific agonist DCPG or modulated with AZ12216052, a new, positive allosteric modulator. The results showed that mGluR8 might be a promising therapeutic target for anxiety.
GRM8 Preparation Options
Creative Biolabs has developed a robust platform for the preparation of purified, stabilized, and functional membrane proteins facilitating your basic scientific research and discovery projects. Our platform enables us to reconstitute your target proteins in stable and functional conformations that maximally preserves their activities. Please see Magic™ membrane protein production platform for more information. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-GRM8 antibody development services.
Over years, our scientists have accumulated considerable experience in the completion of many difficult-to-prepare membrane proteins. We are happy to share our expertise with our valued clients to tailor one-stop, custom-oriented service packages regarding a wide range of membrane protein targets. Contact us to experience the great value of our excellent services.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
