Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of HRH1
Histamine H1 receptor (H1R or HRH1), is an integral membrane protein which in human is encoded by HRH1 gene. It is recognized as a histamine receptor belonging to the family of rhodopsin-like G-protein-coupled receptors and is predominantly expressed in smooth muscles, on vascular endothelial cells, in the heart, and in the central nervous system. This receptor is activated by the biogenic amine histamine. HRH1 is linked to an intracellular G-protein (Gq) that activates phospholipase C and the inositol triphosphate (IP3) signaling pathway.
| Basic Information of HRH1 | |
| Protein Name | Histamine H1 receptor |
| Gene Name | HRH1 |
| Aliases | H1R, HH1R |
| Organism | Homo sapiens (Human) |
| UniProt ID | P35367 |
| Transmembrane Times | 7 |
| Length (aa) | 487 |
| Sequence |
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHTVGNLYIVSLS VADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFILCIDRYRSVQQPLRYLKYRT KTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKCETDFYDVTWFKVMTAIINFYLPTLLMLWFY AKIYKAVRQHCQHRELINRSLPSFSEIKLRPENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTP KEMKSPVVFSQEDDREVDKLYCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQ MLGDSQSFSRTDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFKRILHIRS |
Function of HRH1 Membrane Protein
HRH1 or H1R is activated by endogenous histamine, which is a ubiquitous messenger molecule that is released from enterochromaffin-like cells, mast cells, and neurons. In vascular endothelial cells, stimulation of H1Rs results in the synthesis and release of several neurochemicals and neuromodulators including platelet-activating factor, prostacyclin, and nitric oxide (NO). In addition, stimulation of the H1 receptor leads to changes in vascular permeability, particularly the postcapillary venule as a consequence of endothelial cell contraction, which due to contraction of terminal venules, the release of catecholamine from adrenal medulla, and neurotransmission in the central nervous system. The stimulation of H1R-induced contraction is mediated by inositol 1,4,5-triphosphate-induced mobilization of intracellular calcium. It has been reported to be associated with multiple processes, such as memory and learning, circadian rhythm, and thermoregulation. It is also known to be involved in the pathophysiology of allergic diseases such as asthma, atopic dermatitis, anaphylaxis, and allergic rhinitis. Thus, H1R has been regarded as a useful target for developing anti-allergy drugs.
Fig.1 Structure of H1R membrane protein.
Application of HRH1 Membrane Protein in Literature
Authors in this group focused on regulatory mechanisms of the circadian clocks in vertebrate eyes. And the present results indicated histaminergic control of the molecular clock via H1R in retinal pigment epithelial cells.
This study was carried out to investigate the particular clinical utility of H1R in allergic rhinitis and urticaria. The findings indicated that the kinetics of these fluorescent ligands could also be monitored in membrane preparations providing new opportunities for future drug discovery applications.
In this article, the participation of histamine and H1R on the increased dorsal telencephalic neurogenesis was explored. This study opened a new perspective on the participation of HA and H1R receptor in early corticogenesis in health and disease.
The data demonstrated that histamine, via the H1R, modified SD morphological and functional integrity, in part, by decreasing the expression of ZO-1 and P-cadherin.
The results of this article confirmed the value of the label-free methods, DMR and ECIS, for the characterization of H1R ligands. Both noninvasive techniques were complementary to each other, but cannot fully replace reductionist signaling pathway focused assays.
HRH1 Preparation Options
The Magic™ membrane protein production platform in Creative Biolabs allows robust reconstitution forms as well as multiple active formats for membrane proteins. To prepare the soluble and functional target protein of your interest, our experienced scientists present robust reconstitution forms as well as multiple active formats for membrane proteins. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HRH1 antibody development services.
With the world’s broadest range of knowledge in membrane protein, Creative Biolabs applies its expertise in a variety of membrane protein studies to offer a comprehensive solution for membrane protein preparation. Please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
