Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of HTR2B
5-hydroxytryptamine receptor 2B (5-HT2B), alternatively called serotonin receptor 2B, is a member of the 5-HT2 receptor for the neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). 5-HT2B is encoded by HTR2B gene in human. It has been found in the stomach fundus, intestine, kidney, heart, and lung, as well as in the brain, specifically in the cerebellum, cerebral cortex, amygdala, substantia nigra, caudate, thalamus, hypothalamus, and retina. HTR2B is also expressed in a number of blood vessels.
| Basic Information of HTR2B | |
| Protein Name | 5-hydroxytryptamine receptor 2B |
| Gene Name | HTR2B |
| Aliases | 5-HT-2B, 5-HT2B |
| Organism | Homo sapiens (Human) |
| UniProt ID | P41595 |
| Transmembrane Times | 7 |
| Length (aa) | 481 |
| Sequence |
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIGG NTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFSTAS IMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLTKER FGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAML DGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQ TTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNPMAENSK FFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV |
Function of HTR2B Membrane Protein
HTR2B or 5-HT2B is a beta-arrestin family member which inhibits signaling by G proteins and mediates activation of alternative signaling pathways. Similar to other 5-HT receptors, the binding of 5-HT2B and its receptor leads to a conformation change that triggers signaling through guanine nucleotide-binding proteins (G proteins) and regulates the activity of downstream effectors. 5-HT2B is involved in the regulation of dopamine and 5-hydroxytryptamine release, 5-hydroxytryptamine uptake and in the regulation of extracellular dopamine and 5-hydroxytryptamine levels, and thus affects neural activity. Furthermore, 5-HT2B has an impact on the regulation of behavior, including impulsive behavior. It is required for normal proliferation of embryonic cardiac myocytes and normal heart development. And it also contributes to protecting cardiomyocytes against apoptosis. In addition, 5-HT2B also plays a role in the adaptation of pulmonary arteries to chronic hypoxia as well as in vasoconstriction. Given the vasodilatory role of the 5-HT2B receptor, recently developed 5-HT2B receptor antagonists may be indicated for the treatment of migraine.
Fig.1 Structure of 5-HT2B membrane protein.
Application of HTR2B Membrane Protein in Literature
The results showed that astroglial 5-HT2B receptors were linked to mood disorders and may represent a novel target for cell- and molecule-specific therapies of depression and mood disorders.
The observations of this study indicated that the 5-HT2B receptor acted as a direct positive modulator of serotonin Pet1-positive neurons in an opposite way as the known 5-HT1A-negative autoreceptor.
This article focused on the subset-specific expression and immunomodulatory function of 5-HT2B in human moDCs. The results expanded the biological role of 5-HT2B which may act not only as a neurotransmitter receptor, but also as an important modulator of both innate and adaptive immune responses.
The findings of this study concluded that the 5-HT2B and 5-HT2C receptor subtypes appeared to be the predominant serotonin receptors that mediated the contractile action of this amine in bovine isolated ciliary muscles.
Authors of this study suggested that 5-HT promoted CCN2 production through the 5-HT2AR in growth plates and that it repressesed CCN2 production through the 5-HT2BR in articular cartilage for harmonized development of long bones.
HTR2B Preparation Options
To prepare the soluble and functional target protein of your interest, our experienced scientists are willing to offer customized services with fast turnaround times. Our Magic™ membrane protein production platform is flexible to offer different options, which can meet the specific requirements of your research. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR2B antibody development services.
Scientists in Creative Biolabs are devoting to offer values added services to our clients all over the world, in an attempt to help to achieve their research goal on membrane protein preparation. Please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
