Close

HTR2C Membrane Protein Introduction

Introduction of HTR2C

5-hydroxytryptamine receptor 2C (HTR2C), alternatively called serotonin receptor 2C, is a G protein-coupled receptor (GPCR) and belongs to the 5-HT2 receptor subfamily which binds the endogenous neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). HTR2C is encoded by HTR2C gene in human and is coupled to Gq/G11 and mediates excitatory neurotransmission. HTR2C receptors are primarily found in the choroid plexus, and also expressed on epithelial cells lining the ventricles. This receptor exists as a homodimer at the cell surface.

Basic Information of HTR2C
Protein Name 5-hydroxytryptamine receptor 2C
Gene Name HTR2C
Aliases Serotonin receptor 2C, 5-hydroxytryptamine receptor 1C, 5-HT-2C, 5-HT2C
Organism Homo sapiens (Human)
UniProt ID P28335
Transmembrane Times 7
Length (aa) 458
Sequence MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGN
ILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASI
MHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPN
FVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQ
NARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVW
IGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEK
ASDNEPGIEMQVENLELPVNPSSVVSERISSV

Function of HTR2C Membrane Protein

The HTR2C receptor is one of the many binding sites for serotonin and belongs to the beta-arrestin family that inhibits signaling by G proteins and mediates activation of alternative signaling pathways. Like other 5-HT receptors, the binding of HTR2C and its ligands results in a conformation change that activates signaling through guanine nucleotide-binding proteins (G proteins) and regulates the activity of downstream effectors. HTR2C may regulate neuronal activity by the activation of short transient receptor potential calcium channels in the brain, and thus regulates the activation of proopiomelanocortin neurons and the release of CRH that then modulates the release of corticosterone. HTR2C is supposed to significantly regulate mood, anxiety, feeding, and reproductive behavior. Activation of HTR2C could inhibit dopamine and norepinephrine release in certain areas of the brain. Moreover, HTR2C is involved in insulin sensitivity and glucose homeostasis. Several studies have indicated that some suicide victims have an abnormally high number of HTR2C receptors in the prefrontal cortex.

Structure of HTR2C membrane protein. Fig.1 Structure of HTR2C membrane protein.

Application of HTR2C Membrane Protein in Literature

  1. Phillips B.U., et al. Selective effects of 5-HT2C receptor modulation on performance of a novel valence-probe visual discrimination task and probabilistic reversal learning in mice. Psychopharmacology (Berl). 2018, 235(7):2101-2111. PubMed ID: 29682701

    The results showed that 5-HT2CRs tightly regulated feedback sensitivity bias in mice with consequent effects on learning and cognitive flexibility and specified a framework for the influence of 5-HT2CRs on sensitivity to reinforcement.

  2. Hankosky E.R. Age- and sex-dependent effects of methamphetamine on cognitive flexibility and 5-HT2C receptor localization in the orbitofrontal cortex of Sprague-Dawley rats. Behav Brain Res. 2018, 349:16-24. PubMed ID: 29715538

    The observations of this study revealed that age and sex differences in drug-induced deficits in reversal learning and 5-HT2CR co-localization with parvalbumin interneurons were dissociable and can manifest independently.

  3. Ouchi M., et al. Effect of a 5-HT2c receptor agonist on urethral closure mechanisms in female rats. Neurourol Urodyn. 2018. PubMed ID: 29624732

    This article showed that 5-HT2c receptors agonists may have dual effects in patients with SUI (stress urinary incontinence), not only by reducing obesity but also by enhancing active urethral closure.

  4. Tavares L.R.R., et al. Activation of 5-HT2C (but not 5-HT1A) receptors in the amygdala enhances fear-induced antinociception: Blockade with local 5-HT2C antagonist or systemic fluoxetine. Neuropharmacology. 2018, 135:376-385. PubMed ID: 29548885

    The findings of this study indicated that 5-HT may facilitate nociception and intensified OAA (arm-induced antinociception), respectively, at 5-HT1A and 5-HT2C receptors located in the amygdala of mice.

  5. Faton S., et al. 5-HT2C receptors in the ventral tegmental area, but not in the arcuate nucleus, mediate the hypophagic and hypolocomotor effects of the selective 5-HT2C receptor agonist AR231630 in rats. Behav Brain Res. 2018, 347:234-241. PubMed ID: 29555337

    Authors of this study suggested that 5-HT2C receptor in the VTA (ventral tegmental area), but not in the ARC (arcuate nucleus), participated in both homeostatic and hedonic food intake and brain reward function.

HTR2C Preparation Options

Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. To prepare the soluble and functional target protein of your interest, our experienced scientists are willing to offer customized services for your research. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR2C antibody development services.


Scientists in Creative Biolabs are devoting themselves to the field of membrane protein preparation to support membrane protein studies. We provide the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for more details.

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

45-1 Ramsey Road, Shirley, NY 11967, USA
Call us at:
USA: 1-631-381-2994
Europe: 44-207-097-1828
Fax: 1-631-207-8356
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us