Creative Biolabs is offering the most comprehensive services for antibody development projects. With strict regulation and effective execution, we are dedicated to providing the most valuable solutions to complete your projects.
HighlightsWith over a decade of experience in phage display technology, Creative Biolabs can provide a series of antibody or peptide libraries that are available for licensing or direct screening. These ready-to-use libraries are invaluable resources for isolating target-specific binders for various research, diagnostic or therapeutic applications. Highlights
Creative Biolabs has established a broad range of platforms for developing novel antibodies or equivalents. These cutting-edge technologies enable our scientists to meet your demands from different aspects and tailor the most appropriate solution that contributes to the success of your projects.
HighlightsWith deep understanding in antibody-related realms and extensive project experience, Creative Biolabs offers a variety of references to help you learn more about our capacities and achievements, including infographic, flyer, case study, peer-reviewed publications, and all kinds of knowledge that can assist your projects. You are also welcome to contact us directly for more specific solutions.
HighlightsGet a real taste of Creative Biolabs, one of the most professional custom service providers in the world. We are committed to providing highly customized comprehensive solutions with the best quality to advance your projects.
HighlightsIntroduction of HTR2C
5-hydroxytryptamine receptor 2C (HTR2C), alternatively called serotonin receptor 2C, is a G protein-coupled receptor (GPCR) and belongs to the 5-HT2 receptor subfamily which binds the endogenous neurotransmitter serotonin (5-hydroxytryptamine, 5-HT). HTR2C is encoded by HTR2C gene in human and is coupled to Gq/G11 and mediates excitatory neurotransmission. HTR2C receptors are primarily found in the choroid plexus, and also expressed on epithelial cells lining the ventricles. This receptor exists as a homodimer at the cell surface.
| Basic Information of HTR2C | |
| Protein Name | 5-hydroxytryptamine receptor 2C |
| Gene Name | HTR2C |
| Aliases | Serotonin receptor 2C, 5-hydroxytryptamine receptor 1C, 5-HT-2C, 5-HT2C |
| Organism | Homo sapiens (Human) |
| UniProt ID | P28335 |
| Transmembrane Times | 7 |
| Length (aa) | 458 |
| Sequence |
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGN ILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASI MHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPN FVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQ NARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVW IGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEK ASDNEPGIEMQVENLELPVNPSSVVSERISSV |
Function of HTR2C Membrane Protein
The HTR2C receptor is one of the many binding sites for serotonin and belongs to the beta-arrestin family that inhibits signaling by G proteins and mediates activation of alternative signaling pathways. Like other 5-HT receptors, the binding of HTR2C and its ligands results in a conformation change that activates signaling through guanine nucleotide-binding proteins (G proteins) and regulates the activity of downstream effectors. HTR2C may regulate neuronal activity by the activation of short transient receptor potential calcium channels in the brain, and thus regulates the activation of proopiomelanocortin neurons and the release of CRH that then modulates the release of corticosterone. HTR2C is supposed to significantly regulate mood, anxiety, feeding, and reproductive behavior. Activation of HTR2C could inhibit dopamine and norepinephrine release in certain areas of the brain. Moreover, HTR2C is involved in insulin sensitivity and glucose homeostasis. Several studies have indicated that some suicide victims have an abnormally high number of HTR2C receptors in the prefrontal cortex.
Fig.1 Structure of HTR2C membrane protein.
Application of HTR2C Membrane Protein in Literature
The results showed that 5-HT2CRs tightly regulated feedback sensitivity bias in mice with consequent effects on learning and cognitive flexibility and specified a framework for the influence of 5-HT2CRs on sensitivity to reinforcement.
The observations of this study revealed that age and sex differences in drug-induced deficits in reversal learning and 5-HT2CR co-localization with parvalbumin interneurons were dissociable and can manifest independently.
This article showed that 5-HT2c receptors agonists may have dual effects in patients with SUI (stress urinary incontinence), not only by reducing obesity but also by enhancing active urethral closure.
The findings of this study indicated that 5-HT may facilitate nociception and intensified OAA (arm-induced antinociception), respectively, at 5-HT1A and 5-HT2C receptors located in the amygdala of mice.
Authors of this study suggested that 5-HT2C receptor in the VTA (ventral tegmental area), but not in the ARC (arcuate nucleus), participated in both homeostatic and hedonic food intake and brain reward function.
HTR2C Preparation Options
Magic™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. To prepare the soluble and functional target protein of your interest, our experienced scientists are willing to offer customized services for your research. Aided by our versatile Magic™ anti-membrane protein antibody discovery platform, we also provide customized anti-HTR2C antibody development services.
Scientists in Creative Biolabs are devoting themselves to the field of membrane protein preparation to support membrane protein studies. We provide the largest and most diverse portfolio of standard and custom professional membrane protein preparation services. Please feel free to contact us for more details.
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.
