Introduction of KCNJ10
Encoded by KCNJ10 gene, KCNJ10 belongs to the Potassium Voltage-Gated Channel Subfamily J which has been extensively studied during the past few decades because it offers numerous possibilities for therapeutic applications. It is responsible for potassium buffering of glial cells in the brain. Recent research indicates that KCNJ10 variations are associated with multiple diseases, include idiopathic epilepsy syndrome.
| Basic Information of KCNJ10 | |
| Protein Name | ATP-sensitive inward rectifier potassium channel 10 |
| Gene Name | KCNJ10 |
| Aliases | BIRK-10, KIR1.2 |
| Organism | Homo sapiens (Human) |
| UniProt ID | P78508 |
| Transmembrane Times | 2 |
| Length (aa) | 379 |
| Sequence | MTSVAKVYYSQTTQTESRPLMGPGIRRRRVLTKDGRSNVRMEHIADKRFLYLKDLWTTFIDMQWRYKLLLFSATFAGTWFLFGVVWYLVAVAHGDLLELDPPANHTPCVVQVHTLTGAFLFSLESQTTIGYGFRYISEECPLAIVLLIAQLVLTTILEIFITGTFLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
Function of KCNJ10 Membrane Protein
KCNJ10, also named ATP-sensitive inward rectifier potassium channel 10, is widely expressed in the brain, kidney, and renal epithelial cells in the central nervous system. Previous research has indicated that KCNJ10 variants are significantly related to EAST syndrome (epilepsy, ataxia, sensorineural deafness, and tubulopathy). In addition, studies indicate that KCNJ10 encodes the inwardly rectifying potassium channel Kir4.1, a primary regulator of membrane excitability and potassium homeostasis, activate K+ channel to cause the development of EAST syndrome.
Fig.1 Mapping the disease locus on KCNJ10. (Scholl, 2009)
Application of KCNJ10 Membrane Protein in Literature
This article conducts a whole exome sequencing in patients who suffer from epilepsy, ataxia, sensorineural deafness, and tubulopathy to investigate the SNP in EAST syndrome. The results show that KCNJ10 variants (p.Asn232Glnfs*14 and p.Gly275Valfs*7) are likely targets for diagnoses and treatment.
Authors examine the genetic variants in a patient with non-syndromic early-onset cerebellar ataxia. The data reveals a novel c.180 T > G (p.Ile60Met) mutation in KCNJ10, which could play an important role in the clinic.
Authors in this group reveal a novel mutation in the KCNJ10 gene could be related to central nervous system symptoms, such as seizures, ataxia, and intellectual disability.
This article focuses on the relationship between KCNJ10 with H3K9me2 and G9a, and the potential mechanism of how H3K9me2 and G9a affect the epileptic seizure activity.
This article reveals Kir4.1 channels and gap junctions play important roles in regulating the concentration of extracellular potassium. Meanwhile, Kir4.1 channels and gap junctions can induce spontaneous epileptic activity
KCNJ10 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-KCNJ10 antibody development services.
As a forward-looking research institute as well as a leading custom service provider in the field of membrane protein, Creative Biolabs has won good reputation among our worldwide customers for successfully accomplishing numerous challenging projects including generation of many functional membrane proteins. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.