Introduction of KCNK7
Potassium channel subfamily K member 7 (KCNK7), also known as K2P7.1 or TWIK3, is encoded by the gene KCNK7. KCNK7 is classified into the family of two-pore-domain potassium (K2P) channels, sharing the same overall architecture with four membrane-spanning segments (M1-M4), two pore domains (P1 and P2), involved in the formation of the selectivity filter, and a large extracellular M1P1 loop. KCNK7 gene is mapped to chromosome 11, in the q13 region, where several candidate diseases have been identified.
| Basic Information of KCNK7 | |
| Protein Name | Potassium channel subfamily K member 7 |
| Gene Name | KCNK7 |
| Aliases | K2P7.1, TWIK3 |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q9Z2T1 |
| Transmembrane Times | 4 |
| Length (aa) | 307 |
| Sequence | MGSLKPWARYLLLLMAHLLAMGLGAVVLQALEGPPARHLQAQVQAELASFQAEHRACLPPEALEELLGAVLRAQAHGVSSLGNSSETSNWDLPSALLFTASILTTTGYGHMAPLSSGGKAFCVVYAALGLPASLALVAALRHCLLPVFSRPGDWVAIRWQLAPAQAALLQAAGLGLLVACVFMLLPALVLWGVQGDCSLLEAIYFCFGSLSTIGLGDLLPAHGRGLHPAIYHLGQFALLGYLLLGLLAMLLAVETFSELPQVRAMVKFFGPSGSRTDEDQDGILGQDELALSTVLPDAPVLGPTTPA |
Function of KCNK7 Membrane Protein
Though containing two pore-forming P domains, KCNK7 alone has not been shown to generate channel activity by itself; however, its activity may need other non-pore-forming proteins. There are several transcript variants encoding different isoforms have been found for KCNK7 gene. It is documented that KCNK7 displays an intriguing GLE sequence in its filter region instead of the G(Y/F/L)G sequence, which is considered to be the K+ channel signature. The KCNK7-formed K2P channels can produce time- and voltage-independent currents opposing membrane depolarization and cell excitability, which is important for widely physiological processes, such as apoptosis, adrenal gland development, and primary hyperaldosteronism, neuronal excitability and altered motor performance, central O2 chemoreception and breathing control, pain signaling, etc. KCNK7 associated pathways are Hepatic ABC Transporters and Activation of cAMP-Dependent PKA.
Fig.1 Ion conduction pathway in K+ channels. (Chen, 2014)
Application of KCNK7 Membrane Protein in Literature
In this article, the authors demonstrated firstly human cloned KCNK7-A subunit and mapped KCNK7 gene to chromosome 11. They also showed that KCNK7 had an intriguing GLE sequence in its filter region instead of the G(Y/F/L)G sequence, which was considered to be the K+ channel signature.
The authors investigated the mRNA genomics changes and significance of important ion channel proteins in patients with atrial fibrillation (AF) and they found that CACNA1C, KCNC3, KCNG1, and KCNK7 mRNA were up-regulated in AF, but KCNA5 is down-regulated.
This article reviewed evidence that dynamic selectivity of K2P channels constituted a new regulatory mechanism of cellular excitability, whose significance is only now becoming appreciated.
The authors found that two novel lncRNAs (ADAMTS9-AS1 and AP000696.2) and four signal transduction-related DCmRNAs (ERBB3, ENSA, KCNK7, MFSD5), which were differentially co-expressed with the two lncRNAs, might be essential in the development of ectoderm and epithelial cells.
KCNK7 Preparation Options
To obtain the soluble and functional target protein, the versatile MemDX™ membrane protein production platform in Creative Biolabs enables many flexible options, from which you can always find a better match for your particular project. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-KCNK7 antibody development services.
In the last decades, Creative Biolabs has successfully generated many functional membrane proteins for our customers. We are happy to tailor one-stop, custom-oriented service packages regarding a variety of membrane protein targets. Please feel free to contact us for more information.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.