Close

LAPTM5 Membrane Protein Introduction

Introduction of LAPTM5

LAPTM5, the full protein name being lysosomal-associated transmembrane protein 5, is encoded by the LAPTM5 gene in humans. The gene encodes a transmembrane receptor which is associated with lysosomes. The encoded protein, also known as E3 protein, may play a role in hematopoiesis. It’s broadly expressed in bone marrow, lymph node and 15 other tissues. It may have a special functional role during embryogenesis and in adult hematopoietic cells.

Basic Information of LAPTM5
Protein Name Lysosomal-associated transmembrane protein 5
Gene Name LAPTM5
Aliases Lysosomal-associated multitransmembrane protein 5, Retinoic acid-inducible E3 protein, KIAA0085
Organism Homo sapiens (Human)
UniProt ID Q13571
Transmembrane Times 5
Length (aa) 262
Sequence MDPRLSTVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRIADLISSFLLITMLFIISLSLLIGVVKNREKYLLPFLSLQIMDYLLCLLTLLGSYIELPAYLKLASRSRASSSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMPHNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRLIKCMNSVEEKRNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV

Function of LAPTM5 Membrane Protein

LAPTM5 (lysosomal-associated protein transmembrane 5) is preferentially expressed in immune cells, which is also known as KIAA0085, and it can interact with the Nedd4 family of ubiquitin ligases. It has been reported that LAPTM5 acts as a positive regulator of inflammatory signaling pathways and cytokine secretion in macrophages. Also, LAPTM5 can negatively regulate TCR expression and T cell activation by promoting CD3ζ degradation in lysosomes. In addition, LAPTM5 may contribute to tumorigenesis in a subset of human cancers. Some publications have indicated that LAPTM5 is related with cell proliferation and viability by G0/G1 cell cycle arrest. Moreover, it may have a special functional role during embryogenesis and in adult hematopoietic cells. LAPTM5 is overexpressed in HeLa cells, and it can induce apoptosis via cleavage of Mcl-1 and Bid via a LAPTM5-associated lysosomal pathway, and the following activation of the mitochondria-dependent caspase cascade. Furthermore, LAPTM5 may contribute to tumorigenesis in different kinds of human cancers.

Model of the relationship between LAPTM5-mediated degeneration and propensity for spontaneous regression of NB tumor Fig.1 Model of the relationship between LAPTM5-mediated degeneration and propensity for spontaneous regression of NB tumor (Inoue, 2009)

Application of LAPTM5 Membrane Protein in Literature

  1. Jun D.Y., et al. Ectopic overexpression of LAPTM5 results in lysosomal targeting and induces Mcl-1 down-regulation, Bak activation, and mitochondria-dependent apoptosis in human HeLa cells. PLoS One. 2017, 12(5):e0176544. PubMed ID: 28464033

    This article demonstrates that LAPTM5 is overexpressed in HeLa cells which induce apoptosis via cleavage of Mcl-1 and Bid by a LAPTM5-associated lysosomal pathway, and subsequent activation of the mitochondria-dependent caspase cascade.

  2. Chen L., et al. Downregulation of LAPTM5 suppresses cell proliferation and viability inducing cell cycle arrest at G0/G1 phase of bladder cancer cells. Int J Oncol. 2017, 50(1):263-271. PubMed ID: 27922670

    This article shows that downregulated LAPTM5 suppresses proliferation and viability, also induces G0/G1 cell cycle arrest, possibly via deactivation of ERK1/2 and p38 in BCa cells.

  3. Nuylan M., et al. Down-regulation of LAPTM5 in human cancer cells. Oncotarget. 2016, 7(19):28320-8. PubMed ID: 27058622

    This study suggests that LAPTM5 deficiency may contribute to tumorigenesis in different subsets of human cancers.

  4. Cai X., et al. Expression and Polymorphisms of Lysosome-Associated Protein Transmembrane 5 (LAPTM5) in Patients with Systemic Lupus Erythematosus in a Chinese Population. Biochem Genet. 2015, 53(7-8):200-10. PubMed ID: 25998573

    This article demonstrates that low expression of LAPTM5 may take part in the pathogenesis of SLE and contribute to the severity of the disease. In a Chinese population, none of LAPTM5 polymorphisms contributes significantly to SLE susceptibility.

  5. Kawai Y., et al. LAPTM5 promotes lysosomal degradation of intracellular CD3ζ but not of cell surface CD3ζ. Immunol Cell Biol. 2014, 92(6):527-34. PubMed ID: 24638062

    This article indicates that CD3ζ can be degraded by two pathways: one is SLAP/c-Cbl, which targets internalized cell surface CD3ζ, and the other is LAPTM5, which targets intracellular CD3ζ.

LAPTM5 Preparation Options

We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced MemDX™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-LAPTM5 antibody development services.


Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful MemDX™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.

Reference

  1. Inoue J, et al. (2009). Lysosomal-associated protein multispanning transmembrane 5 gene (LAPTM5) is associated with spontaneous regression of neuroblastomas. PLoS One. 4(9):e7099.

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2026 Creative Biolabs. | Contact Us