Introduction of LRRC26
LRRC26, Leucine-rich repeat-containing protein 26 is a protein that in humans is encoded by the LRRC26 gene. The expression is found in prostate, colon, salivary gland. This gene is conserved in chimpanzee, rhesus monkey, dog, cow, mouse, rat and chicken. 139 organisms have orthologs with human gene LRRC26. The LRRs-domain of this protein participates in protein-protein interactions and has different functions and cellular locations.
| Basic Information of LRRC26 | |
| Protein Name | Leucine-rich repeat-containing protein 26 |
| Gene Name | LRRC26 |
| Aliases | BK channel auxiliary gamma subunit LRRC26, Cytokeratin-associated protein in cancer, CAPC |
| Organism | Homo sapiens (Human) |
| UniProt ID | Q2I0M4 |
| Transmembrane Times | 1 |
| Length (aa) | 334 |
| Sequence | MRGPSWSRPRPLLLLLLLLSPWPVWAQVSATASPSGSLGAPDCPEVCTCVPGGLASCSALSLPAVPPGLSLRLRALLLDHNRVRALPPGAFAGAGALQRLDLRENGLHSVHVRAFWGLGALQLLDLSANQLEALAPGTFAPLRALRNLSLAGNRLARLEPAALGALPLLRSLSLQDNELAALAPGLLGRLPALDALHLRGNPWGCGCALRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLALRDLAVVYTLGPASFLVSLASCLALGSGLTACRARRRRLRTAALRPPRPPDPNPDPDPHGCASPADPGSPAAAAQA |
Function of LRRC26 Membrane Protein
LRRC26 (Leucine-rich repeat-containing protein 26) is a transmembrane protein with only 1 transmembrane domain. It’s also known as CAPC. It’s a helper protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha). BK channels are composed of the homotetrameric pore-forming voltage, calcium-sensing α subunits (BKα), or associated with regulatory tissue-specific auxiliary β or γ subunits. BK channel auxiliary γ (BKγ) subunits are a group with leucine-rich repeat (LRR) domains, including γ1 (LRRC26), γ2 (LRRC52), γ3 (LRRC55), and γ4 (LRRC38). LRRC26 can modulate the gating characteristics by producing a marked shift in hyperpolarizing direction and in the absence of calcium. These subunits display distinct expression levels in different human tissues. LRRC26 is mainly expressed in secretory glands. Also, in non-excitable cells, it’s required for conversion of BK alpha channels with the state from a high-voltage to a low-voltage activated channel type. In addition, LRRC26 plays a role in myoblast differentiation, and in malignant progression of triple-negative breast cancer. Furthermore, it plays a critical role in supporting normal secretory function in all secretory epithelial cells via BK channels.
Fig.1 Structural features of LRRC26 (Yan, 2012)
Application of LRRC26 Membrane Protein in Literature
This article shows that LRRC26 is associated with the effects of E2 on myoblast differentiation.
This article demonstrates that LRRC26 plays a critical role in the malignant progression of triple-negative breast cancer. LRRC26 deficiency can cause aggressiveness of TNBC cells via a TNF-α/NF-κB-independent mechanism.
This article indicates that LRRC26-containing BK channels are able to contribute to resting K+ efflux at normal cell membrane potentials with resting cytosolic calcium concentrations. It plays a critical role in supporting normal secretory function in all secretory epithelial cells.
This article shows that LRRC26 can interact with BK channels to modulate the function. In non-excitable cells, it allows BK channels to keep an open status even at near physiological Ca2+ concentration and membrane voltage.
This article indicates that functional LRRC26 is expressed in arterial myocytes. And it can enhance channel voltage and apparent calcium sensitivity to induce vasodilation.
LRRC26 Preparation Options
We provide custom membrane protein preparation services for worldwide customers. Leveraging by our advanced MemDX™ membrane protein production platform, we are able to present target membrane protein in multiple active formats. Our professional scientists are happy to help you find an ideal method and make your project a success. Aided by our versatile MemDX™ anti-membrane protein antibody discovery platform, we also provide customized anti-LRRC26 antibody development services.
Creative Biolabs provides high-quality membrane protein preparation service to facilitate the development of worldwide customer’s research. During the past years, we have successfully established a powerful MemDX™ membrane protein platform which enables us to provide a series of membrane protein preparation services. For more detailed information, please feel free to contact us.
Reference
All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.