Close
Close

Magic™ Membrane Protein Human ADAM15 (ADAM metallopeptidase domain 15) Expressed in E.coli with GST tag at the N-terminus for Antibody Discovery, Partial (207-452aa) (CAT#: MPX4466K)

Datasheet
This product is a 53.6kDa Human ADAM15 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ADAM15
  • Protein Length
  • Partial (207-452aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 53.6kDa
  • TMD
  • 1
  • Sequence
  • DVVTETKTVELVIVADHSEAQKYRDFQHLLNRTLEVALLLDTFFRPLNVRVALVGLEAWTQRDLVEISPNPAVTLENFLHWRRAHLLPRLPHDSAQLVTGTSFSGPTVGMAIQNSICSPDFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDLPGNSCPCPGPAPAKTCIMEASTDFLPGLNFSNCSRRALEKALLDGMGSCLFERLPSLPPMAAFCGNMFVEPGEQCDCGFLDDCVDPCCDSLT

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • GST tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • ADAM15
  • Full Name
  • ADAM metallopeptidase domain 15
  • Introduction
  • The protein encoded by this gene is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain. Through its disintegrin-like domain, this protein specifically interacts with the integrin beta chain, beta 3. It also interacts with Src family protein-tyrosine kinases in a phosphorylation-dependent manner, suggesting that this protein may function in cell-cell adhesion as well as in cellular signaling. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
  • Alternative Names
  • ADAM15; MDC15; disintegrin and metalloproteinase domain-containing protein 15; MDC-15; a disintegrin and metalloproteinase domain 15 (metargidin); metalloprotease RGD disintegrin protein; metalloproteinase-like, disintegrin-like, and cysteine-rich protein 15; ADAM metallopeptidase domain 15

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us