Close

Magic™ Membrane Protein Human AP1S1 (Adaptor related protein complex 1 subunit sigma 1) for Antibody Discovery (CAT#: MP0039X)

This product is a 40.37 kDa Human AP1S1 membrane protein expressed in in vitro wheat germ expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • AP1S1
  • Protein Length
  • Full-length
  • Molecular Weight
  • 40.37 kDa
  • Sequence
  • MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH

Product Description

  • Application
  • Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein), Antibody Production, Protein Array
  • Expression Systems
  • in vitro wheat germ expression system
  • Tag
  • GST-tag at N-terminal
  • Purification
  • Glutathione Sepharose 4 Fast Flow
  • Buffer
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer

Target

  • Target Protein
  • AP1S1
  • Full Name
  • Adaptor related protein complex 1 subunit sigma 1
  • Introduction
  • The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle
  • Alternative Names
  • AP19; CLAPS1; FLJ92436; SIGMA1A; WUGSC:H_DJ0747G18.2; AP-1 complex subunit sigma-1A,HA1 19 kDa subunit,clathrin assembly protein complex 1 sigma-1A small chain; clathrin coat assembly protein AP19; clathrin-associated/assembly/adaptor protein, small 1 (19kD),golgi adaptor HA1/AP1 adaptin sigma-1A subunit,sigma

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us