Close

Magic™ Membrane Protein Human APLNR (Apelin receptor) for Antibody Discovery (CAT#: MP0685J)

This product is a 42.5 kDa Human APLNR membrane protein expressed in HEK293T. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • APLNR
  • Protein Length
  • Full-length
  • Protein Class
  • Druggable Genome, GPCR, Transmembrane
  • Molecular Weight
  • 42.5 kDa
  • TMD
  • 7
  • Sequence
  • MEEGGDFDNYYGADNQSECEYTDWKSSGALIPAIYMLVFLLGTTGNGLVLWTVFRSSREKRRSADIFIAS
    LAVADLTFVVTLPLWATYTYRDYDWPFGTFFCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARL
    RLRVSGAVATAVLWVLAALLAMPVMVLRTTGDLENTTKVQCYMDYSMVATVSSEWAWEVGLGVSSTTVGF
    VVPFTIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWP
    CDFDLFLMNIFPYCTCISYVNSCLNPFLYAFFDPRFRQACTSMLCCGQSRCAGTSHSSSGEKSASYSSGH
    SQGPGPNMGKGGEQMHEKSIPYSQETLVVD

Product Description

  • Expression Systems
  • HEK293T
  • Tag
  • C-Myc/DDK
  • Form
  • Powder
  • Purification
  • Anti-DDK affinity column followed by conventional chromatography steps
  • Purity
  • > 80% as determined by SDS-PAGE and Coomassie blue staining
  • Buffer
  • 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
  • Storage
  • Store at +4°C for up to one week or several months at -80°C

Target

  • Target Protein
  • APLNR
  • Full Name
  • Apelin receptor
  • Introduction
  • This gene encodes a member of the G protein-coupled receptor gene family. The encoded protein is related to the angiotensin receptor, but is actually an apelin receptor that inhibits adenylate cyclase activity and plays a counter-regulatory role against the pressure action of angiotensin II by exerting hypertensive effect. It functions in the cardiovascular and central nervous systems, in glucose metabolism, in embryonic and tumor angiogenesis and as a human immunodeficiency virus (HIV-1) coreceptor. Two transcript variants resulting from alternative splicing have been identified.
  • Alternative Names
  • APJ; APJR; HG11; AGTRL1

Related Products

Online Inquiry

Verification code
Click image to refresh the verification code.

CONTACT US

USA:
Europe: UK - Germany
Call us at:
USA:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us