Close

Magic™ Membrane Protein Human ATP6V0D1 (ATPase H+ transporting V0 subunit d1) expressed in E.coli for Antibody Discovery (CAT#: MP1394J)

This product is a 67.3 kDa Human ATP6V0D1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • ATP6V0D1
  • Protein Length
  • Full-length
  • Protein Class
  • Ion Channel
  • Molecular Weight
  • 67.3 kDa
  • Sequence
  • MSFFPELYFNVDNGYLEGLVRGLKAGVLSQADYLNLVQCETLEDLKLHLQSTDYGNFLANEASPLTVSVIDDRLKEKMVVEFRHMRNHAYEPLASFLDFITYSYMIDNVILLITGTLHQRSIAELVPKCHPLGSFEQMEAVNIAQTPAELYNAILVDTPLAAFFQDCISEQDLDEMNIEIIRNTLYKAYLESFYKFCTLLGGTTADAMCPILEFEADRRAFIITINSFGTELSKEDRAKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLNQFHFGVFYAFVKLKEQECRNIVWIAECIAQRHRAKIDNYIPIF

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • ATP6V0D1
  • Full Name
  • ATPase H+ transporting V0 subunit d1
  • Introduction
  • This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously.
  • Alternative Names
  • 32 kDa accessory protein; ATP6D; ATP6DV; ATP6V0D1; ATPase H+ transporting lysosomal (vacuolar proton pump) member D; ATPase H+ transporting lysosomal 38kD V0 subunit d; ATPase H+ transporting lysosomal 38kDa V0 subunit d1; ATPase H+ transporting lysosomal V0 subunit d1; H(+) transporting two sector ATPase subunit D; p39; V ATPase 40 KDa accessory protein; V ATPase AC39 subunit; V ATPase subunit d 1; V ATPase subunit D; V-ATPase 40 kDa accessory protein; V-ATPase AC39 subunit; V-ATPase subunit d 1; V-type proton ATPase subunit d 1; VA0D1_HUMAN; Vacuolar ATP synthase subunit d 1; Vacuolar proton pump subunit d 1; VATX; VMA 6; VMA6; VPATPD

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us