Close

Magic™ Membrane Protein Human BDKRB2 (Bradykinin receptor B2) (CAT#: MP0003F)

The B2R is a receptor for bradykinin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. The B2 receptor mediates slow contraction of various smooth muscles including veins, intestine, uterus, trachea and lung, inducing endothelium-dependent relaxation of arteries and arterioles, and stimulates natriuresis/diuresis in kidney. The B2 receptor couples to Gq and Gi, Gq stimulates phospholipase C to increase intracellular free calcium and Gi inhibits adenylate cyclase. Furthermore, the receptor stimulates the mitogen-activated protein kinase pathways. The B2 receptor also forms a complex with angiotensin converting enzyme (ACE) and this is thought to play a role in cross-talk between the renin-angiotensin system (RAS) and the kinin-kallikrein system (KKS).

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BDKRB2
  • Protein Length
  • Full Length
  • Protein Class
  • Receptor
  • Molecular Weight
  • 44 kDa
  • TMD
  • 7
  • Sequence
  • MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
    PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
    FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
    IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
    TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
    LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
    IQMENSMGTLRTSISVERQIHKLQDWAGSRQ

Product Description

  • Activity
  • Validated by SPRi
  • Application
  • Screening & display technologies, Structural biology, Antibody development
  • Expression Systems
  • Cell-free expression system in the presence of lipid vesicles
  • Tag
  • Histidine tag fused to the N-terminal end of the protein
  • Protein Format
  • Proteoliposome
  • Purification
  • Sucrose gradient
  • Purity
  • >75% by SDS-Page and Coomassie Blue staining
  • Buffer
  • Tris 50mM, pH 7.5

Target

  • Target Protein
  • BDKRB2
  • Full Name
  • Bradykinin receptor B2
  • Introduction
  • This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. Bradykinin is released upon activation by pathophysiologic conditions such as trauma and inflammation, and binds to its kinin receptors, B1 and B2. The B2 receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system.
  • Alternative Names
  • B2R, BK2, BK-2, BKR2, BRB2

Customer reviews and Q&As    

Q&As

Gene structure of bradykinin receptor B2

A related study showed that the genomic clone of BDKRB2 is intronless. While another demonstrated that the BDKRB2 gene contains 3 exons separated by 2 introns. The first and second exons are non-coding, while the third exon contains the full-length coding region.
2022-12-03

Effect of agonists of bradykinin receptor B2

The potent BDKRB2-selective agonist labradimib (Arg-Pro-Hyp-Gly-Thi-Ser-Pro-Tyr(Me)-psi(CH2NH)-Arg) temporarily increases blood-brain barrier (BBB) permeability in the RG2 rat model of glioma and facilitates the entry of chemotherapeutic agents into the CNS to kill brain tumors.
2022-12-03

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us