Close

Magic™ Membrane Protein Human BPIFA1 (BPI fold containing family A member 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX0956K)

This product is a Human BPIFA1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • BPIFA1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Immunity
  • Molecular Weight
  • 40.7kDa
  • Sequence
  • QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • BPIFA1
  • Full Name
  • BPI fold containing family A member 1
  • Introduction
  • This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known.
  • Alternative Names
  • BPIFA1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; ligand-binding protein RYA3; lung-specific protein X; nasopharyngeal carcinoma-related protein; palate lung and nasal epithelium clone protein; palate, lung and nasal epithelium associated; protein Plunc; secretory protein in upper respiratory tracts; short PLUNC1; tracheal epithelium enriched protein; von Ebner protein Hl; BPI fold containing family A member 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us