Close

Magic™ Membrane Protein Human CCR5 (C-C motif chemokine receptor 5) for Antibody Discovery (CAT#: MP1334J)

This product is a 43.9 kDa Human CCR5 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR5
  • Protein Length
  • Full-length
  • Protein Class
  • GPCR
  • Molecular Weight
  • 43.9 kDa
  • TMD
  • 7
  • Sequence
  • MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-10xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR5
  • Full Name
  • C-C motif chemokine receptor 5
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • AM4 7; C C chemokine receptor type 5; C C CKR 5; C-C chemokine receptor type 5; C-C CKR-5; C-C motif chemokine receptor 5 A159A; CC Chemokine Receptor 5; CC Chemokine Receptor Type 5; CC CKR 5; CC-CKR-5; CCCKR 5; CCCKR5; CCR 5; CCR-5; CCR5; CCR5 chemokine (C C motif) receptor 5; CCR5_HUMAN; CD 195; CD195; CD195 Antigen; Chemokine C C motif receptor 5; Chemokine receptor CCR5; CHEMR13; CKR 5; CKR5; CMKBR 5; CMKBR5; FLJ78003; HIV 1 Fusion Coreceptor; HIV-1 fusion coreceptor; HIV1 fusion coreceptor; IDDM22; MIP-1 alpha receptor

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us