Close

Magic™ Membrane Protein Human CCR5 (C-C motif chemokine receptor 5) Expressed in HEK293 for Antibody Discovery, Partial (2-223 aa & 227-319 aa, C58Y, G163N, A233D, K303E) (CAT#: MPX0559K)

This product is a 46.0 kDa Human CCR5 membrane protein expressed in HEK293. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR5
  • Protein Length
  • Partial (2-223 aa & 227-319 aa, C58Y, G163N, A233D, K303E)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 46.0 kDa
  • TMD
  • 7
  • Sequence
  • DYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNML
    VILILINYKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTM
    CQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSV
    ITWVVAVFASLPNIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVI
    LGLVLPLLVMVICYSGILKTLLREKKRHRDVRLIFTIMIVYFLFWAP
    YNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV
    GEEFRNYLLVFFQKHIAKR

Product Description

  • Activity
  • Yes
  • Expression Systems
  • HEK293
  • Tag
  • Flag tag at the N-terminus and His tag at the C-terminus
  • Protein Format
  • Detergent
  • Endotoxin
  • <1.0 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Delivered as bulk protein in a 0.2 μm filtered solution of 50 mM HEPES, 150 mM NaCl, DDM, CHS, pH7.5 with glycerol as protectant.

Target

  • Target Protein
  • CCR5
  • Full Name
  • C-C motif chemokine receptor 5
  • Introduction
  • This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. An allelic polymorphism in this gene results in both functional and non-functional alleles; the reference genome represents the functional allele. Two transcript variants encoding the same protein have been found for this gene.
  • Alternative Names
  • CCR5; CKR5; CCR-5; CD195; CKR-5; CCCKR5; CMKBR5; IDDM22; CC-CKR-5; C-C motif chemokine receptor 5 A159A; HIV-1 fusion coreceptor; chemokine (C-C motif) receptor 5; chemokine receptor CCR5; chemokine recptor CCR5 Delta32; chemr13; C-C motif chemokine receptor 5

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us