Close
Close

Magic™ Membrane Protein Human CCR7 (C-C motif chemokine receptor 7) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (332-378aa) (CAT#: MPX4123K)

Datasheet
This product is a 13.0 kDa Human CCR7 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CCR7
  • Protein Length
  • Partial (332-378aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 13.0 kDa
  • TMD
  • 7
  • Sequence
  • KFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFSP

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CCR7
  • Full Name
  • C-C motif chemokine receptor 7
  • Introduction
  • The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.
  • Alternative Names
  • BLR2; EBI1; CCR-7; CD197; CDw197; CMKBR7; CC-CKR-7; C-C chemokine receptor type 7; Bukitt's lymphoma receptor 2; CC chemokine receptor 7; EBV-induced G protein-coupled receptor 1; Epstein-Barr virus induced gene 1; Epstein-Barr virus-induced G-protein coupled receptor 1; MIP-3 beta receptor; chemokine (C-C motif) receptor 7; lymphocyte-specific G protein-coupled peptide receptor; CCR7; C-C motif chemokine receptor 7

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us