Close
Close

Magic™ Membrane Protein Human CD151 (CD151 molecule (Raph blood group)) Expressed in CHO for Antibody Discovery, Partial (113-221aa) (CAT#: MPX0218K)

Datasheet
This product is a 39 kDa Human CD151 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD151
  • Protein Length
  • Partial (113-221aa)
  • Protein Class
  • Cell adhesion
  • Molecular Weight
  • 39 kDa
  • TMD
  • 4
  • Sequence
  • AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQ
    QEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASN
    IYKVEGGCITKLETFIQEHLR

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD151
  • Full Name
  • CD151 molecule (Raph blood group)
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins and other transmembrane 4 superfamily proteins. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and/or function. This protein enhances cell motility, invasion and metastasis of cancer cells. Multiple alternatively spliced transcript variants that encode the same protein have been described for this gene.
  • Alternative Names
  • CD151; GP27; MER2; RAPH; SFA1; PETA-3; TSPAN24; CD151 antigen; CD151 antigen (Raph blood group); hemidesmosomal tetraspanin CD151; membrane glycoprotein SFA-1; platelet surface glycoprotein gp27; platelet-endothelial cell tetraspan antigen 3; platelet-endothelial tetraspan antigen 3; tetraspanin-24; tspan-24; CD151 molecule (Raph blood group)

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us