Close
Close

Magic™ Membrane Protein Human CD160 (CD160 molecule, 27-159aa) with C-6xHis for Antibody Discovery (CAT#: MP1562J)

Datasheet
This product is a 15.8 kDa Human CD160 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD160
  • Protein Length
  • Partial (27-159aa)
  • Protein Class
  • Drug Target
  • Molecular Weight
  • 15.8 kDa
  • Sequence
  • INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEGTLS

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-58% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

  • Target Protein
  • CD160
  • Full Name
  • CD160 molecule
  • Introduction
  • CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules.
  • Alternative Names
  • BY55; BY55_HUMAN; CD160; CD160 antigen [Precursor]; CD160 antigen; CD160 delta Ig; CD160 molecule; CD160 transmembrane isoform; FLJ46513; Natural killer cell receptor BY55; Natural killer cell receptor; immunoglobulin superfamily member; NK1; NK28; CD160-delta Ig; natural killer cell receptor BY55; natural killer cell receptor, immunoglobulin superfamily member

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us