Close
Close

Magic™ Membrane Protein Human CD274 (CD274 molecule, 19-238aa) with C-hFc tag for Antibody Discovery (CAT#: MP1505J)

Datasheet
This product is a 52.7 kDa Human CD274 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD274
  • Protein Length
  • Partial (19-238aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 52.7 kDa
  • TMD
  • 1
  • Sequence
  • FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Target

  • Target Protein
  • CD274
  • Full Name
  • CD274 molecule
  • Introduction
  • This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • B7-H; B7H1; hPD-L1; PDCD1L1; PDCD1LG1; B7 H; B7 H1; B7 homolog 1; B7-H1; B7H; CD 274; CD274 antigen; CD274 molecule; MGC142294; MGC142296; OTTHUMP00000021029; PD L1; PD-L1; PD1L1_HUMAN; PDCD1 ligand 1; PDCD1L1; PDCD1LG1; PDL 1; PDL1; Programmed cell death 1 ligand 1; Programmed death ligand 1; RGD1566211

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us