Close

Magic™ Membrane Protein Human CD274 (CD274 molecule) Expressed in E.coli with 10xHis tag at the N-terminus, Myc tag at the C-terminus for Antibody Discovery, Partial (19-134aa) (CAT#: MPX4165K)

This product is a 20.8 kDa Human CD274 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD274
  • Protein Length
  • Partial (19-134aa)
  • Protein Class
  • Receptor; Immunity
  • Molecular Weight
  • 20.8 kDa
  • TMD
  • 1
  • Sequence
  • FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis tag at the N-terminus, Myc tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CD274
  • Full Name
  • CD274 molecule
  • Introduction
  • This gene encodes an immune inhibitory receptor ligand that is expressed by hematopoietic and non-hematopoietic cells, such as T cells and B cells and various types of tumor cells. The encoded protein is a type I transmembrane protein that has immunoglobulin V-like and C-like domains. Interaction of this ligand with its receptor inhibits T-cell activation and cytokine production. During infection or inflammation of normal tissue, this interaction is important for preventing autoimmunity by maintaining homeostasis of the immune response. In tumor microenvironments, this interaction provides an immune escape for tumor cells through cytotoxic T-cell inactivation. Expression of this gene in tumor cells is considered to be prognostic in many types of human malignancies, including colon cancer and renal cell carcinoma. Alternative splicing results in multiple transcript variants.
  • Alternative Names
  • CD274; B7-H; B7H1; PDL1; PD-L1; hPD-L1; PDCD1L1; PDCD1LG1; programmed cell death 1 ligand 1; B7 homolog 1; CD274 antigen; PDCD1 ligand 1; CD274 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us