Close

Magic™ Membrane Protein Human CD47 (CD47 molecule, 19-139aa) with C-hFc for Antibody Discovery (CAT#: MP1486J)

This product is a 40.8 kDa Human CD47 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD47
  • Protein Length
  • Partial (19-139aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 40.8 kDa
  • TMD
  • 1
  • Sequence
  • QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-hFc
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Target

  • Target Protein
  • CD47
  • Full Name
  • CD47 molecule
  • Introduction
  • Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
  • Alternative Names
  • Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us