Close

Magic™ Membrane Protein Human CD53 (CD53 molecule) without tag for Antibody Discovery (CAT#: MP0196X)

This product is a 24.3 kDa Human CD53 membrane protein expressed in in vitro wheat germ expression system with proprietary liposome technology. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD53
  • Protein Length
  • Full-length
  • Molecular Weight
  • 24.3 kDa
  • TMD
  • 4
  • Sequence
  • MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Product Description

  • Application
  • Antibody Production
  • Expression Systems
  • in vitro wheat germ expression system with proprietary liposome technology
  • Tag
  • NO
  • Purification
  • None
  • Buffer
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol

Target

  • Target Protein
  • CD53
  • Full Name
  • CD53 molecule
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants
  • Alternative Names
  • MOX44; TSPAN25; CD53 antigen; CD53 glycoprotein; CD53 tetraspan antigen; OTTHUMP00000013686; OTTHUMP00000059505; antigen MOX44 identified by monoclonal antibody MRC-OX44; cell surface antigen; leukocyte surface antigen CD53; tetraspanin-25; transmembrane glycoprotein

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us