Close

Magic™ Membrane Protein Human CD63 (CD63 molecule) Expressed in CHO for Antibody Discovery, Partial (103-203aa) (CAT#: MPX0203K)

This product is a 38 kDa Human CD63 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD63
  • Protein Length
  • Partial (103-203aa)
  • Protein Class
  • Transporter
  • Molecular Weight
  • 38 kDa
  • TMD
  • 4
  • Sequence
  • AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAAN
    YTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLR
    KNV

Product Description

  • Expression Systems
  • CHO
  • Tag
  • hIgG1 Fc tag at the N-terminus
  • Protein Format
  • Soluble
  • Reconstitution
  • Reconstitute at 500 μg/mL in PBS.
  • Endotoxin
  • <0.10 EU per 1 μg of the protein by the LAL method.
  • Purity
  • >95%, by SDS-PAGE visualized with Silver Staining and quantitative densitometry by Coomassie® Blue Staining.
  • Buffer
  • Lyophilized from a 0.2 μm filtered solution in PBS.

Target

  • Target Protein
  • CD63
  • Full Name
  • CD63 molecule
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
  • Alternative Names
  • CD63; MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63 antigen; CD63 antigen (melanoma 1 antigen); granulophysin; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; melanoma-associated antigen ME491; melanoma-associated antigen MLA1; ocular melanoma-associated antigen; tetraspanin-30; tspan-30; CD63 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us