Close

Magic™ Membrane Protein Human CD63 (CD63 molecule) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX4052K)

This product is a Human CD63 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD63
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Transport
  • TMD
  • 4
  • Sequence
  • AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CD63
  • Full Name
  • CD63 molecule
  • Introduction
  • The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. Alternative splicing results in multiple transcript variants encoding different protein isoforms.
  • Alternative Names
  • CD63; MLA1; ME491; LAMP-3; OMA81H; TSPAN30; CD63 antigen; CD63 antigen (melanoma 1 antigen); granulophysin; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; melanoma-associated antigen ME491; melanoma-associated antigen MLA1; ocular melanoma-associated antigen; tetraspanin-30; tspan-30; CD63 molecule

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us