Close

Magic™ Membrane Protein Human CD70 (CD70 molecule) expressed in CHO for Antibody Discovery (CAT#: MP0043Q)

This product is a 18.8 kDa Human CD70 membrane protein expressed in CHO. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD70
  • Protein Length
  • Partial
  • Protein Class
  • ES Cell Differentiation/IPS, Transmembrane
  • Molecular Weight
  • 18.8 kDa
  • TMD
  • 1
  • Sequence
  • HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Product Description

  • Expression Systems
  • CHO
  • Form
  • Powder
  • Endotoxin
  • < 1 EU/μg
  • Purity
  • >95% by SDS-PAGE gel and HPLC analyses
  • Buffer
  • Lyophylized purified protein
  • Storage
  • Store at +4°C for up to one week or several months at -80°C

Target

  • Target Protein
  • CD70
  • Full Name
  • CD70 molecule
  • Introduction
  • The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
  • Alternative Names
  • CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A; CD70 antigen; CD27 ligand; Tumor necrosis factor ligand superfamily member 7; CD70; Ki-24 antigen; surface antigen CD70; tumor necrosis factor ligand 8A

All listed services and products are For Research Use Only. Do Not use in any diagnostic or therapeutic applications.

Related Products

Online Inquiry

CONTACT US

USA:
Europe:
Call us at:
USA:
Europe:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us