Close

Magic™ Membrane Protein Human CD86 (CD86 molecule) for Antibody Discovery (CAT#: MP1481J)

This product is a 26.69 kDa Human CD86 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CD86
  • Protein Length
  • Partial (24-247aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 26.69 kDa
  • TMD
  • 1
  • Sequence
  • APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

Target

  • Target Protein
  • CD86
  • Full Name
  • CD86 molecule
  • Introduction
  • Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Also involved in the regulation of B cells function, plays a role in regulating the level of IgG1 produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation.
  • Alternative Names
  • Activation B7-2 antigen 3; Activation B7-2 antigen; B-lymphocyte activation antigen B7-2 2; B-lymphocyte activation antigen B7-2; B7 2; B7; B7-2; B7.2; B70; B72; B72 antigen; BU63; CD28 antigen ligand 2 2; CD28 antigen ligand 2; Cd28l2; CD28LG2; CD86; CD86 antigen (CD28 antigen ligand 2 B7 2 antigen); CD86 antigen (CD28 antigen ligand 2; B7-2 antigen) 1; 2; CD86 antigen (CD28 antigen ligand 2; B7-2 antigen); CD86 antigen; CD86 molecule; CD86_HUMAN; CLS1; CTLA-4 counter-receptor B7.2 2; CTLA-4 counter-receptor B7.2 2; 3; CTLA-4 counter-receptor B7.2; Early T-cell costimulatory molecule 1; ETC-1; FUN 1; FUN-1; FUN1; LAB72; Ly-58; Ly58; MB7; MB7-2; Membrane glycoprotein; MGC34413; T lymphocyte activation antigen CD86 precursor; T-lymphocyte activation antigen CD86; TS/A-2

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us