Magic™ Membrane Protein Human CHRFAM7A (CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion) Expressed in vitro E.coli expression system, Full Length (CAT#: MPX2524K)

Datasheet

This product is a Human CHRFAM7A membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

Host Species
Human

Target Protein
CHRFAM7A

Protein Length
Full Length

Protein Class
Receptor

Sequence
MQKYCIYQHFQFQLLIQHLWIAANCDIADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILLNWCAWFLRMKRPGEDKVRPACQHKQRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRFRCQDESEAVCSEWKFAACVVDRLCLMAFSVFTIICTIGILMSAPNFVEAVSKDFA

Product Description

Expression Systems
in vitro E.coli expression system

Tag
10xHis tag at the N-terminus

Protein Format
Soluble

Buffer
Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

Target Protein
CHRFAM7A

Full Name
CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion

Introduction
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The family member CHRNA7, which is located on chromosome 15 in a region associated with several neuropsychiatric disorders, is partially duplicated and forms a hybrid with a novel gene from the family with sequence similarity 7 (FAM7A). Alternative splicing has been observed, and two variants exist, for this hybrid gene. The N-terminally truncated products predicted by the largest open reading frames for each variant would lack the majority of the neurotransmitter-gated ion-channel ligand binding domain but retain the transmembrane region that forms the ion channel. Although current evidence supports transcription of this hybrid gene, translation of the nicotinic acetylcholine receptor-like protein-encoding open reading frames has not been confirmed.

Alternative Names
CHRFAM7A; D-10; CHRNA7; NACHRA7; CHRNA7-DR1; CHRNA7-FAM7A fusion protein; CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion; CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) and FAM7A (family with sequence similarity 7A, exons A-E) fusion; Neuronal acetylcholine receptor subunit alpha-7; alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid; alpha-7 nicotinic cholinergic receptor subunit; CHRNA7 (exons 5-10) and FAM7A (exons A-E) fusion

Gene ID
89832

UniProt ID
Q494W8

Customer reviews and Q&As Write a review Ask a question

Related Products

Online Inquiry

	USA: Europe: Germany:
	Call us at: USA: UK: Germany:
	Fax:
	Email: