Close

Magic™ Membrane Protein Human CHRNA3 (Cholinergic receptor nicotinic alpha 3 subunit) Expressed in Baculovirus/Insect expression system with 10xHis tag at the C-terminus for Antibody Discovery, Partial (32-240aa) (CAT#: MPX4629K)

This product is a 26.6 kDa Human CHRNA3 membrane protein expressed in Baculovirus/Insect expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHRNA3
  • Protein Length
  • Partial (32-240aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 26.6 kDa
  • TMD
  • 4
  • Sequence
  • SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL

Product Description

  • Expression Systems
  • Baculovirus/Insect expression system
  • Tag
  • 10xHis tag at the C-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CHRNA3
  • Full Name
  • Cholinergic receptor nicotinic alpha 3 subunit
  • Introduction
  • This locus encodes a member of the nicotinic acetylcholine receptor family of proteins. Members of this family of proteins form pentameric complexes comprised of both alpha and beta subunits. This locus encodes an alpha-type subunit, as it contains characteristic adjacent cysteine residues. The encoded protein is a ligand-gated ion channel that likely plays a role in neurotransmission. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer. Alternatively spliced transcript variants have been described.
  • Alternative Names
  • LNCR2; PAOD2; BAIPRCK; NACHRA3; neuronal acetylcholine receptor subunit alpha-3; cholinergic receptor, nicotinic alpha 3; cholinergic receptor, nicotinic, alpha 3 (neuronal); cholinergic receptor, nicotinic, alpha polypeptide 3; neuronal nicotinic acetylcholine receptor, alpha3 subunit; CHRNA3; Cholinergic receptor nicotinic alpha 3 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us