Close

Magic™ Membrane Protein Human CHRNB2 (Cholinergic receptor nicotinic beta 2 subunit) Expressed in E.coli with 10xHis and V5 tag at the N-terminus for Antibody Discovery, Partial (26-233aa) (CAT#: MPX4155K)

This product is a 31.9 kDa Human CHRNB2 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CHRNB2
  • Protein Length
  • Partial (26-233aa)
  • Protein Class
  • Transporter; Ion channel
  • Molecular Weight
  • 31.9 kDa
  • TMD
  • 4
  • Sequence
  • TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRK

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 10xHis and V5 tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >85% as determined by SDS-PAGE.
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CHRNB2
  • Full Name
  • Cholinergic receptor nicotinic beta 2 subunit
  • Introduction
  • Neuronal acetylcholine receptors are homo- or heteropentameric complexes composed of homologous alpha and beta subunits. They belong to a superfamily of ligand-gated ion channels which allow the flow of sodium and potassium across the plasma membrane in response to ligands such as acetylcholine and nicotine. This gene encodes one of several beta subunits. Mutations in this gene are associated with autosomal dominant nocturnal frontal lobe epilepsy.
  • Alternative Names
  • EFNL3; nAChRB2; neuronal acetylcholine receptor subunit beta-2; acetylcholine receptor, nicotinic, beta 2 (neuronal); beta2 human neuronal nicotinic acetylcholine receptor; cholinergic receptor, nicotinic beta 2; cholinergic receptor, nicotinic, beta 2 (neuronal); cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal); neuronal nicotinic acetylcholine receptor beta 2; CHRNB2; Cholinergic receptor nicotinic beta 2 subunit

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us