Close

Magic™ Membrane Protein Human CLEC4C (C-type lectin domain family 4 member C) Expressed in Mammalian cell expression system with 6xHis tag at the N-terminus for Antibody Discovery, Partial (45-213aa) (CAT#: MPX4264K)

This product is a 24.0kDa Human CLEC4C membrane protein expressed in Mammalian cell expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC4C
  • Protein Length
  • Partial (45-213aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 24.0kDa
  • TMD
  • 1
  • Sequence
  • NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Product Description

  • Expression Systems
  • Mammalian cell expression system
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CLEC4C
  • Full Name
  • C-type lectin domain family 4 member C
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • CLEC4C; DLEC; HECL; BDCA2; CD303; BDCA-2; CLECSF7; CLECSF11; PRO34150; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7; C-type lectin superfamily member 7; blood dendritic cell antigen 2 protein; dendritic cell lectin b; dendritic lectin; C-type lectin domain family 4 member C

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us