Close

Magic™ Membrane Protein Human CLEC4C (C-type lectin domain family 4 member C) Expressed in Yeast with 6xHis tag at the N-terminus for Antibody Discovery, Partial (45-213aa) (CAT#: MPX4422K)

This product is a 22.0kDa Human CLEC4C membrane protein expressed in Yeast. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC4C
  • Protein Length
  • Partial (45-213aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 22.0kDa
  • TMD
  • 1
  • Sequence
  • NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Product Description

  • Expression Systems
  • Yeast
  • Tag
  • 6xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CLEC4C
  • Full Name
  • C-type lectin domain family 4 member C
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type 2 transmembrane protein may play a role in dendritic cell function. Two transcript variants encoding distinct isoforms have been identified for this gene.
  • Alternative Names
  • CLEC4C; DLEC; HECL; BDCA2; CD303; BDCA-2; CLECSF7; CLECSF11; PRO34150; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 11; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 7; C-type lectin superfamily member 7; blood dendritic cell antigen 2 protein; dendritic cell lectin b; dendritic lectin; C-type lectin domain family 4 member C

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us