Close

Magic™ Membrane Protein Human CLEC4D (C-type lectin domain family 4 member D) Expressed in E.coli with 6xHis and SUMO tag at the N-terminus for Antibody Discovery, Partial (39-215aa) (CAT#: MPX4560K)

This product is a 36.7kDa Human CLEC4D membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CLEC4D
  • Protein Length
  • Partial (39-215aa)
  • Protein Class
  • Immunity
  • Molecular Weight
  • 36.7kDa
  • TMD
  • 1
  • Sequence
  • CLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • 6xHis and SUMO tag at the N-terminus
  • Protein Format
  • Soluble
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Tris-based buffer, 50% glycerol

Target

  • Target Protein
  • CLEC4D
  • Full Name
  • C-type lectin domain family 4 member D
  • Introduction
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
  • Alternative Names
  • CLEC4D; MCL; MPCL; CD368; CLEC6; CLEC-6; CLECSF8; Dectin-3; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 8; C-type lectin receptor; C-type lectin superfamily member 8; C-type lectin-like receptor 6; DC-associated C-type lectin 3; Dectin 3; dendritic cell-associated C-type lectin 3; macrophage C-type lectin; C-type lectin domain family 4 member D

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us