Close
Close

Magic™ Membrane Protein Human CRHR1 (Corticotropin releasing hormone receptor 1) expressed in E.coli for Antibody Discovery (CAT#: MP1341J)

Datasheet
This product is a 37.9 kDa Human CRHR1 membrane protein expressed in E.coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CRHR1
  • Protein Length
  • Partial (24-121aa)
  • Protein Class
  • GPCR
  • Molecular Weight
  • 37.9 kDa
  • TMD
  • 7
  • Sequence
  • SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI

Product Description

  • Expression Systems
  • E.coli
  • Tag
  • N-GST
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Purity
  • >90% as determined by SDS-PAGE
  • Buffer
  • Liquid: Tris/PBS-based buffer, 5%-50% glycerol
    Lyophilized powder: Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • CRHR1
  • Full Name
  • Corticotropin releasing hormone receptor 1
  • Introduction
  • This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants. Naturally-occurring readthrough transcription between this gene and upstream GeneID:147081 results in transcripts that encode isoforms that share similarity with the products of this gene.
  • Alternative Names
  • Corticotropin releasing factor type 1 receptor; corticotropin releasing hormone receptor 1; Corticotropin-releasing factor receptor 1; Corticotropin-releasing hormone receptor 1; CRF R; crf receptor 1; crf receptor type 1; crf type 1; CRF-R; CRF-R-1; CRF-R1; CRF1; CRFR; CRFR-1; CRFR1; CRFR1_HUMAN; CRH-R-1; CRH-R1; CRH-R1h; CRHR; Crhr1; CRHR1f; CRHR1L

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us