Close

Magic™ Membrane Protein Human CX3CL1 (C-X3-C motif chemokine ligand 1) for Antibody Discovery (CAT#: MP0005Q)

This product is a 10.9 kDa Human CX3CL1 membrane protein expressed in E. coli. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • CX3CL1
  • Protein Length
  • Partial
  • Protein Class
  • Druggable Genome, Secreted Protein, Transmembrane
  • Molecular Weight
  • 10.9 kDa
  • TMD
  • 1
  • Sequence
  • MGSSHHHHHHSSGLVPRGSHMQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNG

Product Description

  • Expression Systems
  • E. coli
  • Tag
  • His
  • Endotoxin
  • < 1 EU/µg
  • Purification
  • Conventional chromatography
  • Purity
  • >90% by SDS - PAGE
  • Buffer
  • PBS, pH 7.4, containing 10% glycerol

Target

  • Target Protein
  • CX3CL1
  • Full Name
  • C-X3-C motif chemokine ligand 1
  • Introduction
  • This gene belongs to the CX3C subgroup of chemokines, characterized by the number of amino acids located between the conserved cysteine residues. This is the only member of the CX3C subgroup, which contains three amino acids between cysteine residues, resulting in a Cys-X-X-X-Cys configuration. The encoded protein contains an extended mucin-like stalk with a chemokine domain on top, and exists in both a membrane-anchored form where it acts as a binding molecule, or, in soluble form, as a chemotactic cytokine. The mature form of this protein can be cleaved at the cell surface, yielding different soluble forms that can interact with the G-protein coupled receptor, C-X3-C motif chemokine receptor 1 gene product. This gene plays a role in a wide range of diseases, including cancer, vasculitis, neuropathies, atherosclerosis, inflammatory diseases, and in human immunodeficiency virus infections.
  • Alternative Names
  • NTN; NTT; CXC3; CXC3C; SCYD1; ABCD-3; C3Xkine; neurotactin; CX3C membrane-anchored chemokine; chemokine (C-X3-C motif) ligand 1; small inducible cytokine subfamily D (Cys-X3-Cys), member 1 (fractalkine, neurotactin); small inducible cytokine subfamily D (Cys-X3-Cys), member-1; small-inducible cytokine D1; Fractalkine; C-X3-C motif chemokine 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us