Close

Magic™ Membrane Protein Human DEGS1 (Delta 4-desaturase, sphingolipid 1) Expressed in vitro E.coli expression system, Full Length of Mature Protein (CAT#: MPX2718K)

This product is a Human DEGS1 membrane protein expressed in vitro E.coli expression system. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • DEGS1
  • Protein Length
  • Full Length of Mature Protein
  • Protein Class
  • Oxidoreductase
  • TMD
  • 6
  • Sequence
  • GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMVLTQLGAFYIVKDLDWKWVIFGAYAFGSCINHSMTLAIHEIAHNAAFGNCKAMWNRWFGMFANLPIGIPYSISFKRYHMDHHRYLGADGVDVDIPTDFEGWFFCTAFRKFIWVILQPLFYAFRPLFINPKPITYLEVINTVAQVTFDILIYYFLGIKSLVYMLAASLLGLGLHPISGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE

Product Description

  • Expression Systems
  • in vitro E.coli expression system
  • Tag
  • 10xHis tag at the N-terminus
  • Protein Format
  • Soluble
  • Buffer
  • Tris/PBS-based buffer, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • DEGS1
  • Full Name
  • Delta 4-desaturase, sphingolipid 1
  • Introduction
  • This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor.
  • Alternative Names
  • DEGS1; MLD; DEGS; DES1; Des-1; FADS7; HLD18; MIG15; DEGS-1; sphingolipid delta(4)-desaturase DES1; cell migration-inducing gene 15 protein; degenerative spermatocyte homolog 1, lipid desaturase; degenerative spermatocyte homolog, lipid desaturase; dihydroceramide desaturase 1; membrane fatty acid (lipid) desaturase; membrane lipid desaturase; migration-inducing gene 15 protein; sphingolipid delta 4 desaturase; sphingolipid delta(4)-desaturase 1; Delta 4-desaturase, sphingolipid 1

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2024 Creative Biolabs. | Contact Us