Close

Magic™ Membrane Protein Human EPHA3 (EPH receptor A3) for Antibody Discovery (CAT#: MP1504J)

This product is a 61.0 kDa Human EPHA3 membrane protein expressed in Mammalian cell. The protein is for research use only and is not approved for use in humans or in clinical diagnosis.

Product Specifications

  • Host Species
  • Human
  • Target Protein
  • EPHA3
  • Protein Length
  • Partial (21-541aa)
  • Protein Class
  • Immune Checkpoints
  • Molecular Weight
  • 61.0 kDa
  • TMD
  • 1
  • Sequence
  • ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ

Product Description

  • Activity
  • Validated by ELISA
  • Expression Systems
  • Mammalian cell
  • Tag
  • C-6xHis
  • Reconstitution
  • Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration).
  • Endotoxin
  • <1.0 EU/μg
  • Purity
  • >95% as determined by SDS-PAGE
  • Buffer
  • 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Target

  • Target Protein
  • EPHA3
  • Full Name
  • EPH receptor A3
  • Introduction
  • Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Highly promiscuous for ephrin-A ligands it binds preferentially EFNA5. Upon activation by EFNA5 regulates cell-cell adhesion, cytoskeletal organization and cell migration. Plays a role in cardiac cells migration and differentiation and regulates the formation of the atrioventricular canal and septum during development probably through activation by EFNA1. Involved in the retinotectal mapping of neurons. May also control the segregation but not the guidance of motor and sensory axons during neuromuscular circuit development.
  • Alternative Names
  • EK4; ETK; HEK; ETK1; HEK4; TYRO4; AW492086; Cek4; EC 2.7.10.1; EK4; End3; Eph receptor A3; EPH-like kinase 4; EPH-like tyrosine kinase 1; EPHA3; EPHA3_HUMAN; Ephrin receptor EphA3; Ephrin type-A receptor 3; ETK 1; ETK; HEK 4; Human embryo kinase 1; Human embryo kinase; Mek4; MGC109882; Receptor tyrosine kinase HEK; Testicular tissue protein Li 64; Tyro 4; Tyro4; TYRO4 protein tyrosine kinase; Tyrosine protein kinase receptor ETK 1; Tyrosine-protein kinase receptor ETK1; Tyrosine-protein kinase TYRO4

Customer reviews and Q&As    

Related Products
Online Inquiry
CONTACT US
USA:
Europe:
Germany:
Call us at:
USA:
UK:
Germany:
Fax:
Email:
Our customer service representatives are available 24 hours a day, 7 days a week. Contact Us
© 2025 Creative Biolabs. | Contact Us